Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SETD7 antibody
The SETD7 antibody is a monoclonal antibody that specifically targets SETD7, an enzyme involved in various cellular processes. This antibody has been shown to react with levothyroxine and interleukin-6, indicating its potential role in modulating thyroid hormone levels and immune responses. Additionally, the SETD7 antibody has demonstrated reactivity towards basic proteins such as collagen, suggesting its involvement in extracellular matrix remodeling. Furthermore, this monoclonal antibody may have implications in cholinergic signaling due to its reactivity with acetylcholine and acetyltransferase. Overall, the SETD7 antibody shows promise as a versatile tool for studying protein function and exploring potential therapeutic applications.TP53 antibody
The TP53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the TP53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The TP53 antibody binds to the collagen and actin filaments within cells, allowing for the detection and study of TP53 expression levels.CD133 antibody
The CD133 antibody is a monoclonal antibody that specifically targets the alpha-fetoprotein. It belongs to a class of antibodies known as inhibitory factors, which have been extensively studied in the field of Life Sciences. This monoclonal antibody has shown high affinity and specificity for its target, making it an ideal tool for various research applications.PCBP1 antibody
The PCBP1 antibody is a highly specialized monoclonal antibody that is used in various life sciences applications. It specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. This antibody can be used for bioassays, as well as in research studies investigating the role of β-catenin in different cellular processes.NOG antibody
The NOG antibody is a monoclonal antibody that targets the growth factor, colony-stimulating factor. It is used as a medicament in the field of Life Sciences and has various biochemical properties. The NOG antibody has been shown to inhibit the activity of 3-kinase and glucokinase, which are enzymes involved in cellular signaling pathways. It also blocks the action of necrosis factor-related apoptosis-inducing and phosphatase enzymes. Additionally, this antibody has been found to reduce microvessel density and exhibit anti-tumor effects. Its ability to target tnf-α and induce apoptosis makes it a valuable tool in research related to cell death and immune response.
PLK1 antibody
The PLK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PLK1 protein, which plays a crucial role in cell division and proliferation. This antibody has been extensively studied and characterized for its high specificity and affinity towards PLK1.
CD24 antibody
The CD24 antibody is a monoclonal antibody that specifically targets the surface glycoprotein CD24. It has been shown to induce apoptosis in cancer cells by binding to CD24 and triggering cell death pathways. In addition to its apoptotic effects, the CD24 antibody also exhibits immunomodulatory effects, making it a promising candidate for cancer immunotherapy. This antibody is widely used in life sciences research, particularly in studies involving antibodies and immunohistochemical detection. The CD24 antibody is produced using advanced techniques that ensure high purity and specificity. It is available as a chemical reagent for laboratory use and can be conjugated with various labels for different applications. Whether you are studying cancer biology or developing novel therapeutics, the CD24 antibody is an essential tool for your research.RXR gamma antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.CASP8AP2 antibody
CASP8AP2 antibody was raised in rabbit using the N terminal of CASP8AP2 as the immunogenDegré de pureté :Min. 95%PRMT2 antibody
PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILCD117 antibody (Azide Free)
CD117 antibody was raised in rat using murine CD117/c-Kit as the immunogen.RXRB antibody
RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG
Laminin Beta 3 antibody
Laminin Beta 3 antibody was raised using the middle region of LAMB3 corresponding to a region with amino acids ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDDegré de pureté :Min. 95%TFF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound that belongs to the class of antituberculosis drugs known as rifamycins. It is highly effective in treating tuberculosis infections. This drug exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.ZNF177 antibody
ZNF177 antibody was raised in rabbit using the N terminal of ZNF177 as the immunogen
Degré de pureté :Min. 95%RAS antibody
RAS antibody was raised in mouse using recombinant human NRAS (1-186aa) purified from E. coli as the immunogen.G3BP1 antibody
The G3BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets and neutralizes the adeno-associated virus (AAV), which is commonly used as a vector in gene therapy applications. By inhibiting the activity of AAV, this antibody prevents viral replication and can be used to study the effects of AAV on cellular processes.LTK antibody
LTK antibody is a highly specialized test compound used in Life Sciences research. It is an antibody that specifically targets and binds to the LTK protein, which plays a crucial role in various cellular processes. This antibody is commonly used in assays to study the function and activity of LTK in different cell types, including pluripotent stem cells and isolated retinal cells.Amphetamine antibody
The Amphetamine antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and interacts with amphetamine, a powerful stimulant drug. This antibody has been extensively studied for its potential in inhibiting the growth and proliferation of hepatocytes and endothelial cells. Additionally, it has shown promising results in combination with other antibodies, such as trastuzumab, for targeting specific growth factors involved in various diseases. The Amphetamine antibody has been found to bind to proteins like collagen, β-catenin, fibronectin, and VEGF-C, which are crucial for cell growth and development. Its anti-her2 antibody properties make it a valuable tool in research and therapeutic applications.Degré de pureté :>90%Bcl6 antibody
The Bcl6 antibody is a highly specialized monoclonal antibody that targets the Bcl6 protein. This protein plays a crucial role in regulating the immune response and is activated in certain diseases, such as lymphoma. The Bcl6 antibody binds specifically to the Bcl6 protein, blocking its activity and preventing it from promoting cell growth and survival.
HSD17B1 antibody
HSD17B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAALRRC6 antibody
LRRC6 antibody was raised using the N terminal of LRRC6 corresponding to a region with amino acids LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFLα 2 Macroglobulin antibody
alpha 2 Macroglobulin antibody was raised in goat using human alpha 2 Macroglobulin purified from plasma as the immunogen.
