Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75562 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
ZEB2 antibody
The ZEB2 antibody is a powerful tool in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the ZEB2 protein, which plays a crucial role in various biological processes. It has been shown to inhibit the activation of angptl3, epidermal growth factor, collagen, and hepatocyte growth factor. The ZEB2 antibody is highly specific and exhibits high affinity for its target, making it an ideal choice for immunohistochemistry, Western blotting, and other experimental techniques. With its cytotoxic properties and low-molecular-weight characteristics, this antibody is a valuable asset in the study of growth factors and their impact on cellular pathways.RNMT antibody
RNMT antibody was raised using a synthetic peptide corresponding to a region with amino acids ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQDECR2 antibody
DECR2 antibody was raised using the N terminal of DECR2 corresponding to a region with amino acids MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRp14 ARF antibody
The p14 ARF antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in regulating cell growth and proliferation by inhibiting the activity of certain growth factors, such as insulin and TNF-α. This polyclonal antibody has been extensively tested and proven to have high specificity and affinity for its target protein. It is commonly used in various applications, including Western blotting, immunohistochemistry, and ELISA assays. The p14 ARF antibody has also been shown to have neutralizing properties against adalimumab, a therapeutic antibody used in the treatment of autoimmune diseases. Additionally, this antibody has been used in studies on cryptosporidium, a parasitic protozoan that causes gastrointestinal infections. With its diverse range of applications and reliable performance, the p14 ARF antibody is an essential tool for researchers in the field of Life Sciences.HSF1 antibody
The HSF1 antibody is a growth factor that is commonly used in Life Sciences research. It plays a crucial role in the regulation of collagen synthesis and is particularly important for human hepatocytes. The antibody has also been shown to inhibit elastase activity and the production of TGF-beta, which are both involved in tissue damage and inflammation. Additionally, it can bind to pancreatic elastase and prevent its harmful effects on the pancreas. The HSF1 antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. Its high specificity and sensitivity make it an essential tool for various applications, including hybridization assays and polymerase chain reactions (PCR).RPS7 antibody
RPS7 antibody was raised using the N terminal of RPS7 corresponding to a region with amino acids MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKELDHA antibody
LDHA antibody was raised using the N terminal of LDHA corresponding to a region with amino acids ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVERK1/2 antibody
The ERK1/2 antibody is a monoclonal antibody that targets the extracellular signal-regulated kinase 1 and 2 (ERK1/2). It plays a crucial role in cell signaling pathways, including those involved in immune response and cell proliferation. This antibody specifically binds to ERK1/2, inhibiting their activity and preventing downstream signaling events.SDS antibody
The SDS antibody is a monoclonal antibody that specifically targets Tumor Necrosis Factor-alpha (TNF-α), a growth factor involved in various inflammatory processes. This antibody works by binding to TNF-α and neutralizing its activity, thereby reducing inflammation. Additionally, the SDS antibody has been shown to have specific binding affinity for epidermal growth factor-like proteins, natriuretic peptides, fibronectin, collagen, and autoantibodies. With its high specificity and neutralizing properties, the SDS antibody is a valuable tool in life sciences research for studying the role of TNF-α and other growth factors in various biological processes.CEA antibody
The CEA antibody is a glycoprotein that is commonly found in human serum. It is widely used in Life Sciences research and has shown potential in various applications. The CEA antibody can be activated to bind to specific antigens, making it a valuable tool for the detection and analysis of target molecules. This monoclonal antibody has been extensively studied and has been shown to have cytotoxic effects on cancer cells. Additionally, it has been found to inhibit the growth factor signaling pathways and regulate mitogen-activated protein activity. The CEA antibody is a versatile and powerful tool that can be used in various research fields and holds great promise for future advancements in biomedical research.PPP1R8 antibody
PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYFenitrothion antibody
The Fenitrothion antibody is a powerful tool used in research and diagnostics. It specifically targets the molecule Icos, which plays a crucial role in immune response regulation. This antibody is highly specific and can effectively detect autoantibodies in human serum, making it invaluable in the study of autoimmune disorders. Additionally, it has cytotoxic properties that make it useful for targeted therapy against certain diseases. The Fenitrothion antibody can also be used to detect thrombocytopenia, as well as to study the expression of urokinase plasminogen activator and collagen. Whether you're conducting groundbreaking research or need accurate diagnostic results, this monoclonal antibody is an essential tool in your arsenal.
Donkey anti Goat IgG (H + L) (biotin)
Donkey anti-goat IgG (H + L) (biotin) was raised in donkey using goat IgG (H & L) as the immunogen.Ku80 antibody
The Ku80 antibody is a serotonergic antibody that targets the c-myc protein. It is widely used in the Life Sciences field for various applications. This polyclonal antibody is derived from human serum and specifically recognizes the fatty acid-activated nuclear alpha-fetoprotein hormone peptide. The Ku80 antibody can be used in experiments involving immunohistochemistry, Western blotting, and ELISA assays. Its high specificity and affinity make it an ideal tool for detecting and quantifying the target antigen. Whether you're conducting research or developing diagnostic tests, the Ku80 antibody is a valuable asset in your laboratory.LRP antibody (515 kDa)
LRP antibody (515 kDa) was raised in mouse using human LRP/a2MR as the immunogen.EME1 antibody
EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDISPeanut Protein Antibody
The Peanut Protein Antibody is a highly versatile and effective product with a wide range of characteristics and applications. It possesses antiviral properties and acts as a growth factor, making it an essential tool in various research fields. This antibody has been extensively studied for its ability to combat infections caused by Mycoplasma genitalium and its potential for inhibiting hemolysis.SMN1 antibody
SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVMAF antibody
The MAF antibody is a polyclonal antibody used in Life Sciences. It is designed to target specific proteins and molecules, such as helicobacter, botulinum toxin, β-catenin, epidermal growth factor, and more. This antibody has been extensively tested and proven to be effective in various applications, including Western blotting, immunohistochemistry, and ELISA.GTPBP9 antibody
GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHCDH2 antibody
The CDH2 antibody is a monoclonal antibody that targets the CDH2 protein expressed in various tissues, including rat liver microsomes. This antibody is widely used in Life Sciences research to study the role of CDH2 in different biological processes. It has been shown to have cholinergic and catecholaminergic properties, affecting neurotransmitter release and signaling pathways. Additionally, the CDH2 antibody has been found to modulate the expression of interleukin-6 and dopamine in rat liver microsomes. Its binding to the CDH2 protein leads to lysis of target cells and inhibition of cellular functions. Researchers also utilize this antibody to detect the presence of CDH2 in samples using techniques like immunofluorescence or Western blotting. The CDH2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs.Apolipoprotein E antibody
The Apolipoprotein E antibody is a polyclonal antibody that specifically targets the colony-stimulating factor (CSF) Apolipoprotein E. This antibody has been shown to have neutralizing effects on the toxic effects of CSF, making it a valuable tool for research in the field of immunology. It has also been shown to inhibit the activity of alpha-fetoprotein and family kinase inhibitor, further highlighting its versatility in various applications. The Apolipoprotein E antibody can be used in immunoassays such as ELISA or Western blotting to detect and quantify the presence of this protein in biological samples. With its high specificity and affinity, this monoclonal antibody is an essential tool for researchers studying the role of Apolipoprotein E in various physiological processes.PR6 antibody
The PR6 antibody is a highly specialized monoclonal antibody with unique characteristics. It has been extensively studied for its hybridization capabilities and its ability to bind to the amino-terminal region of specific proteins. This antibody exhibits high viscosity, making it ideal for use in assays that require increased sensitivity.Neuropilin 1 antibody
The Neuropilin 1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the neuropilin 1 molecule, which plays a crucial role in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.CSTF2 antibody
CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA
