Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75562 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD3 antibody
CD3 antibody was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.STAR antibody
The STAR antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to glial fibrillary acidic protein (GFAP), a protein primarily found in the cytoskeleton of astrocytes. This antibody has been extensively validated for its high specificity and sensitivity in detecting GFAP expression in various tissues and cell types.TRIM38 antibody
The TRIM38 antibody is a powerful tool used in the field of biomedical research. It is a polyclonal antibody that specifically targets TRIM38, an oxidase-like protein involved in various cellular processes. This antibody can be used to detect and quantify TRIM38 in pluripotent stem cells, making it an essential component for studying the role of this protein in stem cell biology.PCT monoclonal antibody
The PCT monoclonal antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets annexin, a protein involved in the regulation of phosphorylcholine. This monoclonal antibody is produced by a hybridoma cell strain, which is a fusion of two different types of cells - a B-cell and a myeloma cell.TNF alpha antibody
TNF alpha antibody was raised in mouse using human recombinant tumor necrosis factor alpha as the immunogen.RAB10 antibody
RAB10 antibody was raised in Mouse using a purified recombinant fragment of human RAB10 expressed in E. coli as the immunogen.NOLA3 antibody
NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKACDC antibody
ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPCYP27C1 antibody
CYP27C1 antibody was raised using the middle region of CYP27C1 corresponding to a region with amino acids VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL
Perforin antibody
Perforin antibody was raised in mouse using purified granules from human YT lymphoma cell line as the immunogen.NUP62 antibody
NUP62 antibody was raised using the N terminal of NUP62 corresponding to a region with amino acids SGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPAPEA15 antibody
The PEA15 antibody is a polyclonal antibody that specifically targets interleukin-6 (IL-6), an inflammatory cytokine involved in various physiological processes. This antibody acts as an inhibitory factor for IL-6, preventing its activation and downstream signaling pathways. Additionally, the PEA15 antibody has been shown to have neutralizing effects on other proteins, such as epidermal growth factor (EGF) and glycine.FASTKD2 antibody
FASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMRBRaf antibody
The BRaf antibody is a highly specific antibody used in various life science applications. It is commonly used to detect and measure the levels of BRaf protein in samples. This antibody has been extensively validated and shown to have high affinity and specificity for BRaf.IRAK1 antibody
The IRAK1 antibody is a high-quality polyclonal antibody that specifically targets and binds to interleukin-1 receptor-associated kinase 1 (IRAK1). This antibody is crucial in life sciences research as it plays a vital role in the innate immune response. It has been extensively used to study the signaling pathways involved in inflammatory responses and autoimmune diseases.Progesterone Receptor antibody
The Progesterone Receptor antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the progesterone receptor, a protein involved in various physiological processes. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which makes it useful for studying angiogenesis and tumor growth. In addition, it has been used to detect the presence of the progesterone receptor in various cell types, including MCF-7 breast cancer cells. The Progesterone Receptor antibody is activated by binding to its target protein and can be used in a variety of assays, such as ELISA or immunohistochemistry. Its high specificity and affinity make it an essential tool for researchers studying hormone signaling pathways and related diseases.ATP5B antibody
ATP5B antibody was raised using the C terminal of ATP5B corresponding to a region with amino acids MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH
Rubisco antibody
The Rubisco antibody is a polyclonal antibody that plays a crucial role in iron homeostasis. It binds to Rubisco, an enzyme involved in the fixation of carbon dioxide during photosynthesis. This antibody has been shown to have high affinity for Rubisco and can be used in various applications, including Western blotting and immunohistochemistry. Additionally, the Rubisco antibody has been found to have lipid binding properties, suggesting its potential involvement in lipid metabolism. Its iron binding capabilities make it a valuable tool for studying iron-related processes such as nitrogen metabolism and transferrin-mediated iron uptake. Moreover, this monoclonal antibody has shown neutralizing activity against influenza hemagglutinin, making it a promising candidate for the development of antiviral therapeutics.TPD52L1 antibody
TPD52L1 antibody was raised in mouse using recombinant human TPD52L1 (1-131aa) purified from E. Coli as the immunogen.PAK7 antibody
The PAK7 antibody is a highly specialized product in the field of Life Sciences. It is an anti-MERTK antibody that specifically targets and binds to the activated form of the MERTK protein. This antibody is designed to facilitate antigen-antibody reactions, making it an essential tool for various research applications.
Nexilin antibody
Nexilin antibody was raised using a synthetic peptide corresponding to a region with amino acids EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKICampylobacter jejuni antibody
Campylobacter jejuni antibody is a monoclonal antibody that specifically targets and binds to the antigen present in Campylobacter jejuni, a bacterium commonly associated with foodborne illnesses. This antibody has been widely used in Life Sciences research to study the pathogenesis of Campylobacter infections and develop diagnostic tests. It can also be used as an inhibitor to block the activity of certain proteins, such as c-myc or epidermal growth factor receptor, which are activated by Campylobacter infection. Additionally, this antibody has shown potential in detecting the presence of Campylobacter jejuni in various samples, including adipose tissue or alpha-fetoprotein. Its high specificity and affinity make it a valuable tool for researchers and professionals working in microbiology or infectious diseases.
