Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75562 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Oncostatin M antibody
The Oncostatin M antibody is a polyclonal antibody that specifically targets and neutralizes oncostatin M (OSM), a cytokine involved in various biological processes. This antibody is widely used in life sciences research to study the role of OSM in different cellular pathways and disease conditions.MCM5 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the rifamycins class. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
TBC1D10A antibody
TBC1D10A antibody was raised in rabbit using the C terminal of TBC1D10A as the immunogenAnti-Müllerian hormone antibody
The Anti-Müllerian hormone antibody is a monoclonal antibody that specifically targets and binds to Anti-Müllerian hormone (AMH). This antibody is widely used in the field of Life Sciences for various research applications. It has been extensively studied and proven to be highly specific and sensitive in detecting AMH levels in human serum samples.STXBP1 antibody
STXBP1 antibody was raised in rabbit using the middle region of STXBP1 as the immunogenCACNB3 antibody
CACNB3 antibody was raised using the C terminal of CACNB3 corresponding to a region with amino acids EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHAnti-CPV Antibody
The Anti-CPV Antibody is a highly effective and specialized monoclonal antibody used in the field of Life Sciences. This antibody has been extensively studied for its ability to inhibit the growth factor of adeno-associated virus (AAV) and has shown antiangiogenic activity. It works by targeting low-density lipoproteins (LDL) and adeno-associated virus, preventing their endocytic uptake into cells. Additionally, this antibody has demonstrated its potential as an anti-neoplastic agent due to its ability to inhibit collagen glycation and lipid peroxidation. With its remarkable properties, the Anti-CPV Antibody is a valuable tool in research and development within the field of Life Sciences.C1orf144 antibody
C1orf144 antibody was raised using the N terminal of C1orf144 corresponding to a region with amino acids MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSNGRIK2 antibody
GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKFactor IX antibody (HRP)
Factor IX antibody (HRP) was raised in sheep using human Factor IX purified from plasma as the immunogen.
IL5 antibody
IL5 antibody was raised in rabbit using highly pure recombinant human IL-5 as the immunogen.ASL antibody
ASL antibody was raised using the middle region of ASL corresponding to a region with amino acids LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDKCD10 antibody
CD10 antibody was raised in Mouse using a purified recombinant fragment of CD10 expressed in E. coli as the immunogen.Nucleobindin 2 antibody
Nucleobindin 2 antibody was raised using the C terminal of NUCB2 corresponding to a region with amino acids FFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHPPP4R2 antibody
PPP4R2 antibody was raised using the C terminal of PPP4R2 corresponding to a region with amino acids DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNESENP1 antibody
SENP1 antibody was raised using the middle region of SENP1 corresponding to a region with amino acids PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLLSGLT2 antibody
The SGLT2 antibody is a highly specialized monoclonal antibody that acts as an inhibitor of the sodium-glucose cotransporter 2 (SGLT2). It is designed to target and neutralize the activity of SGLT2, which plays a key role in glucose reabsorption in the kidneys. By inhibiting SGLT2, this antibody helps to reduce blood glucose levels by increasing urinary glucose excretion.SOS2 antibody
The SOS2 antibody is a polyclonal antibody that specifically binds to actin filaments. It has high affinity for actin and can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. The antibody shows strong binding to actin in human serum and has been used to detect autoantibodies in autoimmune diseases. Additionally, the SOS2 antibody can bind to other proteins such as serum albumin, cation, cellulose, arginase, glutamate, and fatty acid. Its ability to form disulfide bonds ensures stability and reliable performance in experiments. Whether you're studying cell biology or conducting research on protein interactions, the SOS2 antibody is an essential tool for your laboratory.PDK1 antibody
The PDK1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets and binds to PDK1, a key enzyme involved in various cellular processes. This antibody has been extensively tested and proven to be highly specific and sensitive in detecting PDK1 in various biological samples.RPS14 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections by targeting and inhibiting bacterial growth. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication within bacteria. In addition, it has been extensively studied using advanced techniques such as patch-clamp, which have confirmed its high efficacy in human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Moreover, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth. With its bactericidal activity and proven effectiveness, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a reliable choice for combating tuberculosis infections.Glycogen Synthase antibody
The Glycogen Synthase antibody is a versatile tool used in various research applications. It plays a crucial role in the regulation of glycogen synthesis, making it an essential factor in understanding metabolic processes and diseases related to glucose metabolism.
