Anticorps primaires

Rabbit Polyclonal AurB antibody

Mouse monoclonal HA1C antibody

The SYVN1 antibody is a powerful tool in the field of Life Sciences. It specifically targets sirtuins, a group of enzymes involved in various cellular processes such as DNA repair and metabolism regulation. By inhibiting the activity of sirtuins, this antibody can provide valuable insights into their function and potential therapeutic applications.

GRB14 antibody was raised in Rabbit using Human GRB14 as the immunogen

IL12RB1 antibody was raised in Rabbit using Human IL12RB1 as the immunogen

Rat monoclonal CD104 antibody (biotin)

UBE2D3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF

Rabbit Polyclonal B4GALT3 antibody

Luteinizing hormone beta antibody was raised in mouse using human luteinizing hormone as the immunogen.

RNF20 antibody was raised using the N terminal of RNF20 corresponding to a region with amino acids LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS

DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL

IL2 antibody was raised in rat using recombinant Mouse IL-2 as the immunogen.

Mouse monoclonal SNX9 antibody

The CMKLR1 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and neutralizes the alpha-fetoprotein, a protein associated with various diseases and conditions. This antibody can be used for a wide range of applications, including research, diagnostics, and therapeutics. It has been extensively tested and validated to ensure its high specificity and effectiveness.

Rabbit polyclonal MEKKK4 antibody

Rabbit polyclonal PUB15 antibody

Mouse monoclonal SLFNL1 antibody

GAMT antibody was raised using the N terminal of GAMT corresponding to a region with amino acids MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM

Mouse monoclonal PACSIN3 antibody

RPS15A antibody was raised using the middle region of RPS15A corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH

RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE

Rabbit polyclonal Kinase E11 antibody

SYCP3 antibody was raised using the N terminal of SYCP3 corresponding to a region with amino acids VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE

Rabbit polyclonal PUB16 antibody

CBFB antibody was raised in Rabbit using Human CBFB as the immunogen

The Myoglobin antibody is an activated monoclonal antibody that belongs to the category of Life Sciences products. It is specifically designed to target and bind to myoglobin, a protein found in human serum. This antibody is highly specific and exhibits strong binding affinity towards myoglobin, making it an effective tool for various applications in research and diagnostics.

GPSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA

The ORC2 antibody is a powerful tool used in Life Sciences research. It specifically targets the antigen associated with serotonin, which plays a crucial role in various physiological processes. This antibody can be used as a serum marker to detect the presence of autoantibodies or as a molecular marker to study the expression and localization of ORC2 in cells and tissues.

DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR

The Daxx antibody is a highly specialized medicament used in Life Sciences. It is an antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody has been shown to inhibit the glycosylation process of EGF, preventing its activation and subsequent signaling pathways. Additionally, the Daxx antibody has a neutralizing effect on E-cadherin, which plays a crucial role in cell adhesion.

Rabbit polyclonal RAB10 antibody

BMP4 antibody was raised in Rabbit using Human BMP4 as the immunogen

C7orf10 antibody was raised in Rabbit using Human C7orf10 as the immunogen

KEAP1 antibody was raised in Rabbit using Human KEAP1 as the immunogen

BACE1 antibody was raised in Rabbit using Human BACE1 as the immunogen

Rabbit polyclonal MRPS12 antibody

GOLGA1 antibody was raised in Rabbit using Human GOLGA1 as the immunogen

The p90RSK antibody is a monoclonal antibody that is used in Life Sciences research. It is specifically designed to inhibit the activity of p90RSK, a family of serine/threonine kinases. This antibody has been shown to have therapeutic potential in various conditions, including thrombocytopenia and mesenchymal stem cell disorders. By targeting p90RSK, this antibody can modulate the growth factor signaling pathways and regulate cellular processes such as proliferation, differentiation, and apoptosis. Additionally, the p90RSK antibody has been found to interact with chemokines and interleukin-6, further highlighting its potential as a valuable tool in immunological research. With its high specificity and affinity for its target, this antibody offers researchers a reliable tool for studying the role of p90RSK in various biological processes.

Rabbit Polyclonal OR5M3 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. With its bactericidal activity, it is highly effective in treating tuberculosis infections. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Anti Cephapirin C monoclonal

A2BP1 antibody was raised using the middle region of A2BP1 corresponding to a region with amino acids TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP

Synaptophysin antibody was raised in mouse using Synaptophysin from presynaptic vesicles prepared from bovine brain as the immunogen.

Mouse monoclonal UBA2 antibody