Anticorps primaires

KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

alpha Actinin 2 antibody was raised using the C terminal of ACTN2 corresponding to a region with amino acids  VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD

The NMDAR1 antibody is a monoclonal antibody that specifically targets the N-methyl-D-aspartate receptor subunit 1 (NMDAR1). This receptor plays a crucial role in synaptic plasticity and memory formation. The NMDAR1 antibody has been extensively studied in the field of neuroscience and has shown promising results in various applications.

Rabbit Polyclonal KCTD3 antibody

Rabbit polyclonal PRND antibody

Affinity purified Rabbit polyclonal DNAJB2 antibody

Affinity purified Rabbit polyclonal MIPP antibody

Rabbit polyclonal TPP2 antibody

SRA antibody was raised in Mouse using a purified recombinant fragment of SRA expressed in E. coli as the immunogen.

BDNF antibody was raised in Rabbit using Human BDNF as the immunogen

The STEAP1 antibody is a highly specialized antibody that targets the phosphatase STEAP1. This antibody has cytotoxic properties and has been shown to disrupt actin filaments, leading to cell death. It is available as both polyclonal and monoclonal antibodies, offering researchers a range of options for their experiments. In the field of Life Sciences, this antibody is widely used for its neutralizing effects on STEAP1 activity. The monoclonal antibody variant has been specifically designed to be activated upon binding to STEAP1, ensuring optimal performance in immunoassays. With its high affinity and specificity, this antibody can be used in various applications such as Western blotting, immunofluorescence, and flow cytometry. Researchers can rely on the STEAP1 antibody to accurately detect and measure the levels of this important glycoprotein in their experiments.

Rabbit polyclonal NFKP p65 antibody

The CDH3 antibody is a highly specialized monoclonal antibody that targets the CDH3 protein. It is produced by hybridoma cells and has been extensively studied in the field of Life Sciences. This antibody plays a crucial role in regulating cell growth and signaling pathways.

The CD133 antibody is a powerful tool used in various assays and research studies. It is an antibody that specifically targets and binds to the CD133 protein, which is expressed on the surface of certain cells. This antibody can be used to detect and quantify CD133 expression levels in different samples, such as tissues, cell cultures, or body fluids.

The PDK1 antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It specifically targets alpha-fetoprotein, a protein that is expressed in various tissues including cardiomyocytes. The PDK1 antibody has been shown to have neutralizing effects on chemokines, which play a crucial role in inflammation and immune response. This antibody can be used as a research tool to study the function and regulation of chemokines in different biological processes. Additionally, the PDK1 antibody has been found to inhibit the activity of β-catenin, an important signaling molecule involved in cell proliferation and differentiation. This inhibition can have implications for cancer research and therapeutics development. The PDK1 antibody is produced using advanced techniques in monoclonal antibody production and undergoes rigorous quality control to ensure its efficacy and specificity. It is formulated with excipients that maintain its stability and functionality.

TRSPAP1 antibody was raised using the middle region of TRSPAP1 corresponding to a region with amino acids KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM

The CD147 antibody is a versatile and potent steroid that has antidiabetic properties. It acts by inhibiting the activity of phosphatase, which plays a crucial role in regulating blood glucose levels. Additionally, this antibody can modulate chemokine activity, making it an effective tool for studying immune responses.

The TIG2 antibody is a specific antibody that targets the chemokine and growth factor TIG2. It is a polyclonal antibody that has been shown to have neutralizing properties against TGF-beta, a key regulator of cell growth and differentiation. This antibody can be used in various life science applications, including research and diagnostics. The TIG2 antibody is highly specific and has been tested for its ability to bind to fibronectin and other proteins involved in cellular adhesion. It is available as a monoclonal antibody, which ensures consistent performance and high purity. This antibody can be used to detect the presence of TIG2 in samples, making it a valuable tool for studying the role of this protein in various biological processes. Additionally, it can be used to investigate autoantibodies or antibodies produced by the immune system that target TIG2, providing insights into autoimmune diseases or other immune-related disorders. With its exceptional specificity and neutralizing properties, the TIG2 antibody

Rabbit Polyclonal CAPN12 antibody