Anticorps primaires

Ketamine antibody is a monoclonal antibody that specifically targets sclerostin, a protein involved in bone metabolism. This antibody can be used in various assays to detect and quantify sclerostin levels in biological samples. The high specificity and sensitivity of this antibody make it an ideal tool for research in the field of bone biology and related diseases. Additionally, the colloidal gold conjugation of this antibody allows for easy visualization and detection in immunoassays. Whether you are studying the role of sclerostin in osteoporosis or investigating potential therapeutic interventions, this ketamine antibody is an essential tool for your research.

Affinity purified Rabbit polyclonal Lipoic acid synthetase antibody

KLHL11 antibody was raised in Mouse using a purified recombinant fragment of human KLHL11 expressed in E. coli as the immunogen.

Rabbit polyclonal hnRNPM antibody

RAGE antibody was raised using the N terminal of RAGE corresponding to a region with amino acids MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL

The ERCC1 antibody is a highly specialized monoclonal antibody that has cytotoxic properties. It is designed to specifically target and neutralize the alpha-fetoprotein, which is a protein associated with certain types of cancer. The antibody works by binding to the alpha-fetoprotein, preventing its interaction with other proteins and inhibiting its function.

The PELI1 antibody is an anti-HER2 antibody that plays a crucial role in endocytic uptake. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets HER2, a protein that is overexpressed in certain cancer cells, including breast cancer. By binding to HER2, the PELI1 antibody inhibits its signaling pathway and prevents the growth and proliferation of cancer cells.

Mouse Monoclonal Estradiol 17B antibody

Mouse monoclonal RDH11 antibody

FAM156A antibody was raised in Rabbit using Human FAM156A as the immunogen

The Annexin I antibody is a valuable tool in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody has been extensively tested and proven to be highly effective in a variety of applications.

The Bub1 Antibody is a highly specialized test substance used in Life Sciences research. It is a monoclonal antibody that specifically targets the phosphatase Bub1. This antibody has neutralizing and cytotoxic properties, making it an essential tool for studying the role of Bub1 in various cellular processes. Additionally, the Bub1 Antibody can be used as a diagnostic reagent to detect abnormal levels of Bub1 in samples, providing valuable insights into disease mechanisms. Its high specificity and affinity make it an ideal choice for researchers working with adipose tissue, as well as those studying the function of angptl3 and lipoprotein lipase. With its immunogenic compositions, this antibody offers a reliable and efficient means of investigating the impact of Bub1 on cellular functions and developing potential therapeutic interventions.

The AMPD2 antibody is a monoclonal antibody that specifically targets the human serum-activated form of AMPD2. This antibody binds to AMPD2, which is an enzyme involved in the metabolism of adenosine monophosphate (AMP). Autoantibodies against AMPD2 have been found in individuals with certain autoimmune disorders. This antibody can be used in Life Sciences research as a test substance to study the role of AMPD2 in various cellular processes. Additionally, the AMPD2 antibody has been shown to inhibit the activity of high-sensitivity C-reactive protein (hsCRP), which is an inflammatory marker. Furthermore, this antibody has also been found to modulate the expression of leukemia inhibitory factor (LIF) and mitogen-activated protein (MAP) kinases, suggesting its potential use in pluripotent cell research.

The Beta tubulin antibody is a powerful tool used in Life Sciences research. It specifically targets the beta tubulin protein, which is involved in cell division and maintaining the structure of cells. This monoclonal antibody has been extensively tested and validated for its high specificity and sensitivity.

DDX28 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQS

LPL antibody was raised in rabbit using the C terminal of LPL as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

IRF2BP1 antibody was raised using the middle region of IRF2BP1 corresponding to a region with amino acids LVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQ

The BRCA1 antibody is a growth factor that has been extensively studied in the field of Life Sciences. It has shown promising results in various experiments, including phorbol-induced differentiation and interferon-mediated signaling pathways. This monoclonal antibody has been used for neutralizing experiments, electrophoresis, and as an electrode in various research studies. The BRCA1 antibody is produced using a state-of-the-art lyophilization method to ensure its stability and efficacy. It is also available as an anticoagulant for specific applications. This antibody is highly specific and can be used to detect autoantibodies or as a tool for studying the expression of BRCA1 protein in different tissues.

Affinity purified Rabbit polyclonal AMPK gamma 2 antibody

CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK

The Myc antibody is a growth factor that plays a crucial role in various cellular processes. It is a polymorphic protein that can be targeted by specific antibodies for cytotoxic purposes. The Myc antibody can be used in various research applications, such as immunoblotting, immunohistochemistry, and electrophoresis. Monoclonal antibodies against Myc are highly specific and provide accurate results in detecting the presence of this protein. These antibodies can also be used as inhibitors to study the function of Myc in different biological systems. The Myc antibody targets the c-myc gene, which encodes for a transcription factor involved in cell proliferation and apoptosis. Additionally, this monoclonal antibody has been used as an anti-VEGF therapy due to its ability to bind to VEGF receptors and inhibit angiogenesis. With its high specificity and affinity towards the target antigen, the Myc antibody is an essential tool for researchers studying cellular processes and developing therapeutic strategies against various diseases.