Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.709 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(738 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
Affichez 1 plus de sous-catégories
75327 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
PNMA1 antibody
PNMA1 antibody was raised using the middle region of PNMA1 corresponding to a region with amino acids LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANHALMS1 antibody
The ALMS1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ALMS1 protein, which is an oncogene homolog. The antibody has been extensively tested and validated for its specificity and sensitivity. It can be used in various applications such as Western blotting, immunohistochemistry, and ELISA.
CSF1 antibody
CSF1 antibody was raised in Mouse using a purified recombinant fragment of human CSF1 expressed in E. coli as the immunogen.Histone H4 antibody
Histone H4 antibody is a polyunsaturated antibody that specifically targets the histone H4 protein. This antibody has been shown to neutralize the activity of arachidonic acid, a key molecule involved in various biological processes. By blocking the action of arachidonic acid, this antibody can inhibit the angiogenic response and reduce inflammation. It has also been used in Life Sciences research to study the effects of chemical inhibitors on erythropoietin and other angiogenesis-related proteins. Additionally, this monoclonal antibody has been utilized to investigate the role of histone H4 in arachidonic acid metabolism and its impact on cellular processes. With its high specificity and ability to target activated histone H4 residues, this antibody is an essential tool for studying the intricate mechanisms of arachidonic acid signaling pathways and their involvement in various physiological and pathological conditions.MCL1 antibody
The MCL1 antibody is a monoclonal antibody used in clinical settings for immunohistochemistry. It specifically targets the protein kinase CYP2A6 and is commonly used in Life Sciences research. This antibody plays a crucial role in the detection and analysis of MCL1 protein expression, making it a valuable tool in various scientific studies. Additionally, the MCL1 antibody has potential therapeutic applications as an effective medicament against certain diseases. Its high specificity and sensitivity make it a reliable choice for immunohistochemical detection, providing accurate and reliable results. Whether used in research or clinical settings, this monoclonal antibody offers great potential for advancing scientific understanding and improving patient care.UCHL1 antibody
The UCHL1 antibody is a powerful tool used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody targets UCHL1, a growth factor that plays a crucial role in various biological processes.
CRP antibody
The CRP antibody is a highly effective growth factor that activates insulin and is commonly used in the field of Life Sciences. This monoclonal antibody has been specifically designed to target and neutralize phosphatase, which plays a crucial role in various biological processes. The CRP antibody is produced using advanced colloidal techniques, ensuring high purity and potency.TNFC antibody
TNFC antibody is a powerful tool used in Life Sciences research for studying the role of tumor necrosis factor (TNF) in various biological processes. This polyclonal antibody specifically targets TNF and can be used to detect and quantify its presence in samples. TNFC antibody binds to TNF, preventing its interaction with its receptors and inhibiting downstream signaling pathways. It has been extensively used to study the effects of TNF on epidermal growth factor signaling, insulin sensitivity, lipoprotein lipase activity, and glutamate release in mesenchymal stem cells. Additionally, TNFC antibody has been employed in autoimmune disease research to investigate the presence of autoantibodies against TNF or its receptors. Researchers also use monoclonal antibodies such as anti-HER2 antibody or trastuzumab alongside TNFC antibody to study complex protein interactions and signaling pathways involving TNF. With its high specificity and sensitivity, TNFC antibody is an invaluable tool for understanding the role of TNFClaudin 1 antibody
The Claudin 1 antibody is an acidic monoclonal antibody that specifically targets the claudin 1 protein. It is commonly used in Life Sciences research to study the role of claudin 1 in various cellular processes. This antibody has been shown to have neutralizing effects on claudin 1, which plays a crucial role in cell adhesion and tight junction formation. By blocking the function of claudin 1, this antibody can inhibit the growth and migration of cells. Additionally, it has been found to have neurotrophic properties and can promote the survival and differentiation of neurons. The Claudin 1 antibody is a valuable tool for researchers studying cell biology, cancer biology, and neurobiology.FGFR4 Antibody
The FGFR4 Antibody is a powerful inhibitor that targets the protein kinase activity of fibroblast growth factor receptor 4 (FGFR4). This monoclonal antibody specifically binds to FGFR4, blocking its activation and preventing downstream signaling pathways. It has been shown to have high affinity for human serum albumin, making it suitable for use in various research applications.PKC gamma antibody
PKC gamma antibody is a monoclonal antibody that specifically targets and inhibits the activity of protein kinase C gamma (PKC gamma). It is designed to selectively bind to PKC gamma, preventing its activation and downstream signaling pathways. This antibody utilizes a biocompatible polymer linker group with a disulfide bond for stability and cytotoxicity.
SHH antibody
The SHH antibody is a monoclonal antibody that specifically targets the Sonic Hedgehog (SHH) protein. It is used in Life Sciences research to study the function and regulation of SHH signaling pathway. The SHH protein plays a crucial role in embryonic development, cell differentiation, and tissue regeneration. This antibody can be used for various applications such as Western blotting, immunohistochemistry, and flow cytometry to detect and quantify the expression of SHH protein in different biological samples. Additionally, the SHH antibody has been shown to have potential therapeutic applications in diseases related to abnormal SHH signaling, including certain types of cancer and developmental disorders. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying SHH-related pathways and exploring new therapeutic strategies.PRPF4 antibody
PRPF4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITCHCHD1 antibody
CHCHD1 antibody was raised using the middle region of CHCHD1 corresponding to a region with amino acids KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLHNRPUL1 antibody
HNRPUL1 antibody was raised using the C terminal of HNRPUL1 corresponding to a region with amino acids TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ
Fibrinopeptide A antibody (HRP)
Fibrinopeptide A antibody (HRP) was raised in sheep using Synthetic Fibrinopeptide A 1-16 conjugated to carrier as the immunogen.
Nucleobindin 2 antibody
Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEVitronectin antibody (HRP)
Vitronectin antibody (HRP) was raised in sheep using human Vitronectin purified from plasma as the immunogen.NF kappaB p65 antibody
The NF kappaB p65 antibody is a glycoprotein that plays a crucial role in various cellular processes, including the regulation of immune responses and inflammation. It is a mitogen-activated protein that acts as a transcription factor and controls the expression of genes involved in cell survival, proliferation, and differentiation.FADS1 antibody
FADS1 antibody was raised using the C terminal of FADS1 corresponding to a region with amino acids FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLITLN2 antibody
ITLN2 antibody was raised using the middle region of ITLN2 corresponding to a region with amino acids TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQACNTF antibody
The CNTF antibody is a polyclonal antibody used in Life Sciences research. It is designed to specifically target and bind to CNTF (Ciliary Neurotrophic Factor), a protein involved in neural development and survival. This antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA.NOTCH2 antibody
The NOTCH2 antibody is a powerful tool used in life sciences research. It is an electrode that specifically targets the circumsporozoite protein, neutralizing its activity. This antibody has been shown to have a high affinity for acidic environments and effectively binds to tyrosine residues on the target protein.RALY antibody
RALY antibody was raised using the middle region of RALY corresponding to a region with amino acids TQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGAGGGGGGGGSGGGGSPKC gamma antibody
The PKC gamma antibody is a highly effective neutralizing monoclonal antibody that targets the protein kinase C gamma (PKCγ). This antibody acts as a potent family kinase inhibitor, blocking the activity of PKCγ and preventing its role in cell signaling pathways. By inhibiting PKCγ, this antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help inhibit the growth of blood vessels and limit angiogenesis. Additionally, it can bind to alpha-fetoprotein (AFP), a tumor marker expressed in certain cancers, and neutralize its effects.
MTRR antibody
MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
SDCCAG8 antibody
SDCCAG8 antibody was raised using the middle region of SDCCAG8 corresponding to a region with amino acids IQCDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKM
