Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
FLAG Antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture. Tilmicosin is a macrolide antibiotic widely used in veterinary medicine for respiratory disorders caused by bacteria such as Clostridium perfringens. Its mechanism of actionC18ORF25 antibody
C18ORF25 antibody was raised using the middle region of C18Orf25 corresponding to a region with amino acids STSSSDDDEEVSGSSKTITAEIPGHLDPGFLASDKTSAGNAPLNEEINIA
MMP3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using a patch-clamp technique on human erythrocytes, confirming its high activity. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.IKB alpha antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The active form of this drug has been extensively studied using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.NUDT18 antibody
NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVM
PfHRPII antibody
The PfHRPII antibody is a growth factor that promotes endothelial growth and fatty acid metabolism. It targets annexin A2, an important protein involved in cell signaling and membrane organization. This monoclonal antibody has been extensively studied and shown to have therapeutic potential in various diseases, including cancer. It has been found to inhibit the growth of MCF-7 breast cancer cells and enhance the activity of erythropoietin, a hormone that stimulates red blood cell production. Additionally, this antibody has low density and high specificity for its target, making it an ideal tool for research and diagnostics. Its unique properties make it a valuable asset in studying the role of growth factors, epidermal growth factor (EGF), transforming growth factor-beta (TGF-beta), basic proteins, and annexins in cellular processes. With its exceptional performance and reliability, this PfHRPII antibody is an essential component for any laboratory or research facility seeking to advance their understanding of cell biology.HOM-TES-103 antibody
HOM-TES-103 antibody was raised using the N terminal Of Hom-Tes-103 corresponding to a region with amino acids MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLCytokeratin 19 antibody
Cytokeratin 19 antibody is a monoclonal antibody that specifically targets the cell antigen Cytokeratin 19. It has a high viscosity and can be used in various applications such as immunohistochemistry, flow cytometry, and western blotting. This antibody can be used to detect and quantify Cytokeratin 19 expression in different tissues and cell types. Additionally, it has been shown to inhibit the activity of triglyceride lipase and lipoprotein lipase, which are enzymes involved in lipid metabolism. Furthermore, Cytokeratin 19 antibody has been found to have growth factor-like properties, promoting the proliferation of adipose tissue cells. It is also useful for detecting autoantibodies against phosphatase, lipase, and amyloid plaque in various diseases. Overall, Cytokeratin 19 antibody is a versatile tool for research and diagnostic purposes due to its specificity and wide range of applications.GRK3 antibody
The GRK3 antibody is a highly specialized monoclonal antibody that targets the phosphatase GRK3. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically binds to GRK3, inhibiting its activity and preventing downstream signaling events.HA antibody
The HA antibody is a high-quality polyclonal antibody that is widely used in life sciences research. It is specifically designed to target and neutralize the catalase enzyme, which plays a crucial role in various biological processes. This antibody exhibits strong catalase activity and has been shown to effectively inhibit the reactive properties of catalase. Additionally, it can bind to streptavidin and other peptide agents, making it versatile for use in different experimental setups. The HA antibody is water-soluble and can be easily incorporated into various assays and experiments. It is commonly used to detect and measure antiphospholipid antibodies in human serum samples, making it an essential tool for autoimmune disease research. With its high specificity and affinity, this monoclonal antibody ensures reliable results in any scientific investigation requiring the detection or neutralization of catalase or other related enzymes.
VEGFC antibody
The VEGFC antibody is a highly specific antibody that binds to vascular endothelial growth factor C (VEGFC). This antibody plays a crucial role in the field of Life Sciences and is widely used in various research applications. It has been shown to have high affinity for VEGFC and can be used for ultrasensitive detection of this protein.MPI antibody
MPI antibody is a monoclonal antibody used in Life Sciences research. It specifically targets actin filaments and has been shown to be activated by interferon-gamma (IFN-γ) and interleukin-6 (IL-6). This antibody has high affinity and specificity for its target, making it a valuable tool in various experimental applications. Additionally, MPI antibody has been used to study the role of urokinase plasminogen activator (uPA) in human serum and as an anti-MERTK antibody in nuclear staining experiments. Its use can provide valuable insights into cellular processes and signaling pathways.
LGALS3BP antibody
The LGALS3BP antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that has been extensively studied for its neutralizing effects on various proteins and compounds. This antibody has shown potential in inhibiting the activity of taxol, a widely used chemotherapy drug, as well as alpha-fetoprotein, a biomarker for certain types of cancer. The LGALS3BP antibody can also be used in the development of expression plasmids for gene therapy research and in the creation of nanocomposites for targeted drug delivery. Additionally, this antibody has been utilized in the detection and quantification of glutamate levels using electrode-based assays. With its versatility and effectiveness, the LGALS3BP antibody is an indispensable tool for researchers in the Life Sciences field.UBE4A antibody
UBE4A antibody was raised using a synthetic peptide corresponding to a region with amino acids QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYRCDCP1 antibody
The CDCP1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is used for various applications such as immunoassays, cell cytotoxicity studies, and research in the field of anticancer agents.ACSS2 antibody
The ACSS2 antibody is a colony-stimulating antibody that activates the production of specific proteins in human serum. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets c-myc, a protein involved in cell growth and proliferation. By binding to c-myc, the ACSS2 antibody can modulate its activity and regulate cellular processes. Additionally, this antibody has been shown to interact with other proteins such as alpha-fetoprotein (AFP), interferon-gamma (IFN-gamma), glutamate receptors, and phosphatase enzymes. Its acidic nature allows it to effectively target fatty acids and participate in metabolic pathways related to lipid metabolism. With its wide range of applications, the ACSS2 antibody is an essential tool for researchers in the Life Sciences field.NUP88 antibody
The NUP88 antibody is a monoclonal antibody that targets the nuclear pore complex protein Nup88. This protein plays a crucial role in regulating the transport of molecules between the nucleus and cytoplasm. The NUP88 antibody has been shown to have neutralizing activity against tumor necrosis factor-alpha (TNF-α), a pro-inflammatory cytokine involved in various cellular processes, including cell growth and differentiation.
EXOC6 antibody
EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI
