Anticorps primaires

Rabbit polyclonal PLCG1 antibody

LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD

Mouse monoclonal Citrate Lyase antibody (C-terminus)

Mouse monoclonal FAM40A antibody

GSTA4 antibody was raised using the C terminal of GSTA4 corresponding to a region with amino acids LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

AATF antibody was raised in mouse using recombinant Apoptosis Antagonizing Transcription Factor

Mouse monoclonal CDKN3 antibody

Purified Polyclonal HMGN1 antibody

Purified Polyclonal Basonuclin antibody

Purified Rabbit polyclonal p70 S6 Kinase antibody (Ser371)

Mouse monoclonal CALCA antibody

Rabbit polyclonal REG1B antibody

GMCSF antibody was raised in Rat using recombinant human GM-CSF as the immunogen.

Mouse monoclonal ST13 antibody

Rabbit polyclonal SH3D19 antibody

Rabbit polyclonal PYK2 antibody (Tyr580)

Mouse monoclonal NPR3 antibody

Adenovirus antibody was raised in mouse using hexon antigen of human adenovirus as the immunogen.

DBH antibody was raised in mouse using bovine DBH protein as the immunogen.

Human synthetic phosphopeptide (Thr77) region immunogen, Purified Rabbit polyclonal Cyclin E1 antibody (Thr77)

The NPM antibody is a highly reactive antibody that specifically targets Nucleophosmin (NPM), a multifunctional protein involved in various cellular processes. This antibody has been extensively used in research and diagnostics due to its ability to detect NPM in human serum and tissues.

Rabbit polyclonal OR2I1 antibody

Rabbit polyclonal SFXN2 antibody

Mouse monoclonal EIF2B3 antibody

SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

The CDCP1 antibody is a highly effective monoclonal antibody that specifically targets the CDCP1 protein. This antibody is designed to bind to and neutralize the activity of CDCP1, which plays a crucial role in various cellular processes. By blocking the function of CDCP1, this antibody inhibits the formation of CDCP1 dimers and prevents its activation.

Rabbit polyclonal BBTI10 antibody

Rabbit polyclonal RABL2B antibody

PSMA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV

FSH antibody was raised in mouse using human FSH from pituitary as the immunogen.

MIP3 alpha antibody was raised in mouse using highly pure recombinant human MIP-3 alpha as the immunogen.

The TRPV3 antibody is a highly specialized antibody that targets the cation channel TRPV3. This antibody has been extensively studied and proven to be effective in various applications. It can be used as a colloidal or cross-linking agent in experiments involving TNF-α activation. The TRPV3 antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs.

Purified Rabbit polyclonal OR56B4 antibody

Rabbit polyclonal SS18L2 antibody

Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG

The SH3BP5 antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets and binds to SH3BP5, an important protein involved in various cellular processes. This antibody has been extensively studied for its role in interferon signaling and apoptosis induction.

Purified Polyclonal FR gamma antibody

Rabbit polyclonal TrkB antibody (Tyr706+Tyr707)

The LTA4H antibody is a highly effective test substance used in various applications such as electrophoresis, erythropoietin analysis, and phalloidin staining. This antibody specifically targets LTA4H, an enzyme involved in the synthesis of leukotriene B4 (LTB4), which plays a crucial role in inflammation and immune response. The LTA4H antibody is widely used in the field of Life Sciences for research purposes, including the study of actin filaments, growth factors, chemokines, and monoclonal antibodies. It is also utilized as a neutralizing agent or medicament for therapeutic applications. With its high specificity and reliability, the LTA4H antibody is an essential tool for scientists and researchers in their pursuit of understanding complex biological processes.

Mouse monoclonal LDLRAP1 antibody

The HSP90AB1 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the HSP90AB1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and validated for its high specificity and sensitivity.

The RBBP4 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the RBBP4 protein, which plays a crucial role in various cellular processes. This antibody has been shown to bind to albumin and activate it, leading to changes in human serum composition. Additionally, it has been found to interact with alpha-synuclein, a protein associated with neurodegenerative diseases.

ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG

LCMV antibody was raised in mouse using LCMV isolated from human HeLa cells as the immunogen.