Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
Affichez 1 plus de sous-catégories
75447 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
IL1 beta antibody
IL1 beta antibody is a highly effective and versatile antibody that targets the IL1 beta protein, a key player in the immune response and inflammation. This monoclonal antibody specifically binds to IL1 beta, neutralizing its activity and preventing its interaction with its receptor. By inhibiting IL1 beta, this antibody can effectively reduce inflammation and promote healing.Actin antibody
Actin antibody was raised in mouse using synthetic NH2 terminus decapeptide of cardiac isoform of actin as the immunogen.CD31 antibody
CD31 antibody was raised in Mouse using a purified recombinant fragment of human CD31 expressed in E. coli as the immunogen.TSHR antibody
TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISRPDS5A antibody
PDS5A antibody was raised using a synthetic peptide corresponding to a region with amino acids PPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEALRRC57 antibody
LRRC57 antibody was raised using the middle region of LRRC57 corresponding to a region with amino acids NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL
CD18 antibody (Azide Free)
CD18 antibody (Azide free) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.
Anti-Human IgM
Anti-Human IgM is a monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets and binds to the IgM antigen, which is found in human serum. This antibody has been extensively studied and has shown neutralizing properties against various factors such as interferon, growth factors, and alpha-fetoprotein. Additionally, it has been shown to have an affinity for collagen and can be used in research related to collagen synthesis and degradation. Anti-Human IgM is a valuable tool for scientists and researchers working in the field of immunology and antibody-based studies.C21ORF7 antibody
C21ORF7 antibody was raised using the C terminal Of C21Orf7 corresponding to a region with amino acids DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAArtemis antibody (Ser516)
Synthetic human phosphopeptide (Ser516) region immunogen; rabbit polyclonal Artemis antibody (Ser516)ACCN1 antibody
ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIAIHOG antibody
IHOG antibody was raised in Mouse using a purified recombinant fragment of human IHOG expressed in E. coli as the immunogen.Rubella virus antibody (HRP)
Rubella virus antibody (HRP) was raised in goat using Rubeola strain HPV77 as the immunogen.GRF1 antibody
The GRF1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the cyclase-activating domain of GRF1, a protein involved in the regulation of cellular functions. This antibody has been extensively tested and shown to have high specificity and affinity for its target. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The GRF1 antibody is also capable of neutralizing the activity of interferon-gamma (IFN-gamma), making it a valuable tool for studying immune responses. With its wide range of applications and reliable performance, this antibody is an essential component of any research involving GRF1 or IFN-gamma signaling pathways.CXORF26 antibody
CXORF26 antibody was raised using the middle region of Cxorf26 corresponding to a region with amino acids IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTLCD25 antibody (Azide Free)
CD25 antibody (Azide free) was raised in rat using alpha chain IL-2 receptor as the immunogen.
PPP6R1 antibody
PPP6R1 antibody was raised using the N terminal of PPP6R1 corresponding to a region with amino acids MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQTau antibody
The Tau antibody is a highly specialized antibody that targets the epidermal growth factor (EGF) receptor. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of research applications in the field of Life Sciences.
Factor IX antibody (FITC)
Factor IX antibody (FITC) was raised in goat using human Factor IX purified from plasma as the immunogen.Uromodulin antibody
The Uromodulin antibody is a highly specialized biotinylated antibody that is used in various research applications in the field of Life Sciences. This antibody specifically targets and binds to uromodulin, a protein found in high concentrations in human hepatocytes. The Uromodulin antibody has been extensively characterized and validated for its specificity and sensitivity.
p53 antibody
The p53 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation.HCK antibody
HCK antibody was raised in Mouse using a purified recombinant fragment of HCK expressed in E. coli as the immunogen.Lamin A antibody
The Lamin A antibody is a specific antibody that is used as a medicament in various applications. It has the ability to bind to activated Lamin A, which plays a crucial role in regulating gene expression and maintaining the structural integrity of the nucleus. This antibody can be used for research purposes, such as studying protein-protein interactions or investigating the localization and function of Lamin A in different cell types.Vitronectin antibody
The Vitronectin antibody is a monoclonal antibody that specifically targets the growth factor Vitronectin. It has been shown to inhibit the activation of endothelial growth factor and protease activity. This antibody binds to specific target molecules on the surface of cells, preventing their interaction with other proteins and inhibiting their function. In addition, it has cytotoxic effects on certain cancer cells and can induce apoptosis, or programmed cell death. The Vitronectin antibody has also been found to bind to alpha-fetoprotein and necrosis factor-related apoptosis-inducing ligand, further highlighting its potential therapeutic applications in cancer treatment.DDX25 antibody
DDX25 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDVEIF4E antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is particularly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains, leading to the inhibition of cell growth in culture.
