Anticorps primaires

The Vimentin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and detect vimentin, an intermediate filament protein that plays a crucial role in maintaining cell structure and integrity. This antibody is particularly useful in research related to amyloid plaque formation, as it can identify activated vimentin in these structures.

Mouse monoclonal SERPINA5 antibody

The XRCC5 antibody is a polyclonal antibody that is used in various applications in the field of Life Sciences. This antibody is specifically designed to target XRCC5, which is an important protein involved in DNA repair and recombination. The XRCC5 antibody can be used for immobilization on electrodes, making it useful in techniques such as electrochemical immunoassays. Additionally, this antibody has been shown to be effective in detecting hormone peptides, including anti-HBs and c-myc, in human serum samples. It can also be used to study the serotonergic system and investigate the role of XRCC5 in fatty acid metabolism. With its broad range of applications, the XRCC5 antibody is a valuable tool for researchers working in various fields of study within Life Sciences.

Penicillin antibody was raised in mouse using penicillin as the immunogen.

alpha Tubulin 4A antibody was raised using the middle region of TUBA4A corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH

Mouse monoclonal IRF6 antibody

Mouse monoclonal MHC Class I antibody (FITC)

Purified Rabbit polyclonal CK1 alpha antibody (Thr321)

Mouse monoclonal FCGR2A antibody

bFGF antibody was raised in Mouse using recombinant human bFGF as the immunogen.

Mouse monoclonal MRI1 antibody

Rabbit polyclonal CDK11A antibody (HRP)

Rabbit polyclonal UBE2E3 antibody

The VEGFR1 antibody is a powerful diagnostic reagent used in Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes Vascular Endothelial Growth Factor Receptor 1 (VEGFR1). This antibody has cytotoxic properties and is reactive against various growth factors. It can be used for the quantitation of VEGFR1 expression in different tissues, including adipose tissue. The VEGFR1 antibody is highly specific and can be used as an inhibitor in research studies or as a diagnostic tool in clinical settings. Its polymorphic nature allows for versatility and adaptability to different experimental conditions. With its high-quality production and reliable performance, this antibody is an essential tool for researchers and clinicians alike.

C2ORF25 antibody was raised using the middle region of C2Orf25 corresponding to a region with amino acids RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI

The ERBB2 antibody is a monoclonal antibody that acts as a family kinase inhibitor. It specifically targets the epidermal growth factor receptor 2 (ERBB2), which is known to play a critical role in the growth and proliferation of cancer cells. This antibody effectively inhibits the binding of growth factors, such as epidermal growth factor and interleukin-6, to the ERBB2 receptor, thereby preventing the activation of downstream signaling pathways that promote tumor growth.

Mouse monoclonal JEV PreM antibody

Rabbit polyclonal RPC4 antibody

The DEFB1 antibody is a growth factor and family kinase inhibitor protein that is widely used in Life Sciences research. This specific antibody is designed to bind to DEFB1, also known as human beta-defensin 1. It has been extensively validated for its high specificity and affinity towards DEFB1, making it an essential tool for studying the function and regulation of this important protein.

The S6 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize collagen, a protein that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be effective in inhibiting collagen's genotoxic effects.

Purified Polyclonal NAV3 antibody

Mouse monoclonal POLR2E antibody

Rabbit polyclonal SAMD4A antibody

IL2 antibody was raised in Mouse using recombinant human IL-2 as the immunogen.

ALS2CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP

Rabbit polyclonal MNK1 antibody

RC3H2 antibody was raised using the middle region of RC3H2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR

FAM84A antibody was raised using the N terminal of FAM84A corresponding to a region with amino acids GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD

Mouse monoclonal DNTTIP1 antibody

Rabbit polyclonal XPNPEP3 antibody

Rabbit polyclonal Transferrin antibody (FITC)

IL1b antibody is a monoclonal antibody that specifically targets and neutralizes interleukin-1 beta (IL-1β), a pro-inflammatory cytokine involved in various biological processes. IL-1β plays a crucial role in the regulation of immune responses, cell growth, and differentiation. This antibody has been extensively used in research and life sciences to study the function of IL-1β and its inhibitors.

The CDK5 antibody is a highly specialized monoclonal antibody that has neutralizing properties against cyclin-dependent kinase 5 (CDK5). CDK5 is an enzyme involved in various cellular processes, including cell cycle regulation and neuronal development. The CDK5 antibody acts as an inhibitor of CDK5 activity, leading to cytotoxic effects on targeted cells.

The Cytokeratin Antibody Cocktail is a powerful tool for immunohistochemistry and research applications. This cocktail contains a mixture of monoclonal antibodies that specifically target various cytokeratins, which are intermediate filament proteins found in epithelial cells. These monoclonal antibodies have been extensively validated and provide high specificity and sensitivity in detecting cytokeratin expression.

Rabbit polyclonal ZNF699 antibody

The TIMM10 antibody is a polyclonal antibody that specifically targets the TIMM10 protein. This protein is located in the mitochondria and plays a crucial role in various cellular processes, including hormone and growth factor signaling, as well as β-catenin stabilization. The TIMM10 antibody binds to the amino-terminal region of the protein, allowing for its detection and analysis in biological samples.

Mouse monoclonal TOMM34 antibody

PAX6 antibody was raised in Mouse using a purified recombinant fragment of human PAX6 expressed in E. coli as the immunogen.

Mouse monoclonal TCP11L2 antibody

TRIM36 antibody was raised using the middle region of TRIM36 corresponding to a region with amino acids GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR

The Calponin antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Monoclonal Antibodies and is designed for use in human serum. This antibody is specifically designed to target and bind to calponin, a protein involved in various cellular processes.

The RAD51 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the RAD51 protein, which plays a crucial role in DNA repair and recombination. This antibody has been extensively tested and validated for use in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.

WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG