Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75562 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CYB5D1 antibody
CYB5D1 antibody was raised using the middle region of CYB5D1 corresponding to a region with amino acids KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTELWIPI1 antibody
WIPI1 antibody was raised using the N terminal of WIPI1 corresponding to a region with amino acids AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN
RRAGC antibody
RRAGC antibody was raised in mouse using recombinant Human Ras-Related Gtp Binding C (Rragc)HSP27 antibody
The HSP27 antibody is a highly specific monoclonal antibody that targets the HSP27 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and shown to be effective in detecting HSP27 in different biological samples, including human serum and tissue sections.C21orf66 antibody
C21orf66 antibody was raised in rabbit using the N terminal of C21ORF66 as the immunogen
Degré de pureté :Min. 95%SHROOM2 antibody
SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTMCD62E antibody
The CD62E antibody is a highly specialized monoclonal antibody that is used in various Life Sciences assays. It specifically targets and binds to the CD62E molecule, also known as E-selectin, which is a cell adhesion molecule involved in inflammation and immune responses. This antibody is buffered and formulated with collagen-coated microparticles for enhanced stability and performance. The CD62E antibody can be used in combination with other antibodies or reagents to study the expression and function of CD62E in different biological samples, including human serum. Its high specificity and sensitivity make it an essential tool for researchers studying various aspects of cell adhesion, inflammation, and immune system regulation.CTDSPL antibody
CTDSPL antibody was raised using a synthetic peptide corresponding to a region with amino acids CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
AK3 antibody
The AK3 antibody is a highly specialized biomolecule that falls under the category of antibodies in the field of Life Sciences. It possesses unique properties that make it an essential tool for various applications. This monoclonal antibody has been proven to exhibit neutralizing effects against interferons, which are crucial in immune responses and antiviral defense mechanisms.ACSS2 antibody
The ACSS2 antibody is a monoclonal antibody that is used in the field of Life Sciences for various applications. It has been specifically designed to target and bind to ACSS2, an enzyme involved in cellular metabolism. This antibody can be used in research studies to investigate the role of ACSS2 in different biological processes.ACOT11 antibody
ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL
Degré de pureté :Min. 95%GKN1 antibody
The GKN1 antibody is a highly specialized monoclonal antibody that targets the nuclear antigen found in adipose tissues. It is specifically designed to detect and bind to GKN1, a protein produced by adipocytes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting GKN1 in various samples, including human serum.NT5DC2 antibody
NT5DC2 antibody was raised using the N terminal of NT5DC2 corresponding to a region with amino acids IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEVLONRF3 antibody
LONRF3 antibody was raised using the N terminal of LONRF3 corresponding to a region with amino acids QPPPPLRVNVVLSGLLGKLFPGPARASQLRHEGNRLYRERQVEAALLKYNDDX5 antibody
DDX5 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 5 (Ddx5)
C1ORF102 antibody
C1ORF102 antibody was raised using the N terminal Of C1Orf102 corresponding to a region with amino acids MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLNInsulin+Proinsulin antibody
Insulin/proinsulin antibody was raised in mouse using purified mouse insulin and proinsulin as the immunogen.Degré de pureté :>92% By Gel Electrophoresis And Gel ScanningCCR5 antibody
The CCR5 antibody is a highly effective polyclonal antibody that targets the CCR5 chemokine receptor. This receptor plays a crucial role in various immune responses and has been linked to several diseases, including HIV/AIDS. The CCR5 antibody works by binding to the receptor and blocking its activity, thereby inhibiting the entry of HIV into cells.NPY1R antibody
Rabbit polyclonal NPY1R antibody, detects endougenous levels, cross reactive mouse, rat
AURKA antibody
The AURKA antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers working with human serum and studying the effects of red ginseng on various cellular processes. This monoclonal antibody specifically targets and binds to AURKA, a protein that plays a crucial role in granulosa cell function.RAB40B antibody
RAB40B antibody was raised using the middle region of RAB40B corresponding to a region with amino acids YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQDegré de pureté :Min. 95%CTTN antibody
The CTTN antibody is a monoclonal antibody that specifically targets and binds to CTTN (Cortactin) protein. Cortactin is a regulator of actin cytoskeleton dynamics and plays a crucial role in cell migration, adhesion, and invasion. This antibody is widely used in life sciences research to study the function and localization of CTTN in various cellular processes.
SC5DL antibody
SC5DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELVDegré de pureté :Min. 95%
