Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
FAM71B antibody
FAM71B antibody was raised using the middle region of FAM71B corresponding to a region with amino acids RREKKDRHPSRKSSHHRKAGESHRRRAGDKNQKASSHRSASGHKNTRDDKCyclin E1 antibody
Human synthetic cyclin E1 immunogen, Rabbit polyclonal Cyclin E1 antibody, cross-reactive to mouse, rat
KCTD18 antibody
KCTD18 antibody was raised using the N terminal of KCTD18 corresponding to a region with amino acids LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNNAnnexin A7 antibody
Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPC22ORF30 antibody
C22ORF30 antibody was raised using the middle region of C22Orf30 corresponding to a region with amino acids DELDGVKAACPCPQSSPPEQKEAEPEKRPKKVSQIRIRKTIPRPDPNLTPPSMD10 antibody
PSMD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVTopoisomerase II antibody
Topoisomerase II antibody was raised in mouse using recombinant human DNA-topoisomerase IIa (N-terminal fragment) as the immunogen.CDH11 antibody
The CDH11 antibody is a highly effective diagnostic reagent that is used to neutralize the growth factor in microvessel endothelial cells. This monoclonal antibody specifically targets β-catenin, a key protein involved in the formation of epithelial monolayers. By binding to β-catenin, the CDH11 antibody disrupts the protein complex and inhibits its function, leading to a reduction in cell growth and proliferation. This antibody can be used as a therapeutic agent and/or diagnostic reagent for various conditions, including granulosa cell tumors and other diseases characterized by abnormal β-catenin signaling. With its high specificity and potency, the CDH11 antibody is an essential tool for researchers and healthcare professionals alike.WNT9B antibody
WNT9B antibody was raised using the C terminal of WNT9B corresponding to a region with amino acids FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDJAK2 antibody
The JAK2 antibody is a highly specialized monoclonal antibody that targets the Janus kinase 2 (JAK2) protein. This protein plays a crucial role in cellular signaling pathways, specifically in the regulation of cytokine receptors. By binding to JAK2, this antibody effectively inhibits its activity and prevents downstream signaling events.
Keratin K19 antibody
Keratin K19 antibody was raised in Mouse using a purified recombinant fragment of Cytokeratin 19(aa80-400) expressed in E. coli strain as the immunogen.
TSR1 antibody
TSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRVKCNA7 antibody
KCNA7 antibody was raised using the C terminal of KCNA7 corresponding to a region with amino acids GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEVCOX7B antibody
COX7B antibody was raised using the N terminal of COX7B corresponding to a region with amino acids MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCITBC1D21 antibody
TBC1D21 antibody was raised using the N terminal of TBC1D21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC
DLAT antibody
DLAT antibody was raised using a synthetic peptide corresponding to a region with amino acids WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIARATG2A antibody
ATG2A antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRGPAPGAADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMFC9ORF68 antibody
C9ORF68 antibody was raised using the middle region of C9Orf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPGRSU1 antibody
RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKAnnexin A1 antibody
Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDPEG10 antibody
PEG10 antibody was raised in Mouse using a purified recombinant fragment of PEG10(aa1-120) expressed in E. coli as the immunogen.GluR1 antibody
The GluR1 antibody is an activated antibody that targets glutamate receptors in the brain. It has been shown to inhibit the activity of insulin and butyrylcholinesterase, which are enzymes involved in glucose metabolism and neurotransmitter regulation. This antibody can be used in various research applications, such as immunohistochemistry and Western blotting, to study the expression and localization of GluR1 receptors. Additionally, it can be used in life sciences research to investigate the role of GluR1 receptors in neuronal signaling pathways and synaptic plasticity. The GluR1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.
FGF2 antibody
The FGF2 antibody is a monoclonal antibody that specifically targets the epidermal growth factor. It is commonly used in life sciences research to study the effects of FGF2 on various cellular processes. This antibody can be used in experiments such as immunohistochemistry and Western blotting to detect and quantify FGF2 expression levels. Additionally, it can be conjugated with streptavidin for use in techniques like ELISA or flow cytometry. The FGF2 antibody has been shown to have neutralizing properties, meaning it can block the activity of FGF2 and inhibit its effects on cell growth and proliferation. This makes it a valuable tool for studying the role of FGF2 in development, cancer, and other biological processes.KCNH7 antibody
KCNH7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSVPF4 antibody (HRP)
PF4 antibody (HRP) was raised in sheep using Platelet Factor 4 purified from human platelet releasate as the immunogen.
