Anticorps primaires

The TRAIL antibody is a monoclonal antibody that has potent antitumor activity. It works by binding to the tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor, which induces apoptosis in cancer cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting tumor growth and metastasis. Additionally, the TRAIL antibody has been found to be effective in treating ischemia-reperfusion injury and hepatic steatosis. It also exhibits cell lysis activity by targeting CD19-positive cells. The TRAIL antibody can be used as a valuable tool for research purposes or as a potential therapeutic agent for various diseases.

Rabbit Polyclonal APPL2 antibody

Rabbit polyclonal SAR1A antibody

The F9 antibody is a highly specific monoclonal antibody that targets erythropoietin. It is commonly used in various assays and research studies to detect and quantify the presence of erythropoietin in biological samples. This antibody recognizes a specific antigen on erythropoietin and can be used for various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry.

The ZNF410 antibody is a specific antibody used in Life Sciences research. It plays a crucial role as a heparin cofactor and is commonly used in various applications, including the detection of adeno-associated antibodies and autoantibodies. This antibody is also known for its ability to act as a zinc chelator and inhibitor of aminoacyl-tRNA synthetases. In addition, it has been found to modulate the release of neurotransmitters such as dopamine and serotonin. The ZNF410 antibody can serve as a valuable tool for studying the function of this antigen and may also have potential as a serum marker for certain diseases.

CYC1 antibody was raised using the middle region of CYC1 corresponding to a region with amino acids RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP

NOL5A antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK

Mouse monoclonal TTC32 antibody

The ITPR1 antibody is a highly reactive polyclonal antibody that specifically targets the protein kinase inhibitors involved in human folate metabolism. This antibody is capable of neutralizing interferon-gamma and growth factor signaling pathways, making it an essential tool in life sciences research. Whether you're studying cell signaling or investigating immune responses, the ITPR1 antibody provides valuable insights into activated 3-kinase pathways. With its high specificity and reliable performance, this monoclonal antibody is a must-have for any researcher looking to advance their understanding of protein kinase regulation.

Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.

Trichomonas vaginalis antibody was raised in mouse using Trichomonas vaginalis as the immunogen.

The FAM84B antibody is a highly specialized monoclonal antibody that targets the FAM84B protein. This protein plays a crucial role in various biological processes, including cell growth and proliferation. The FAM84B antibody has been extensively studied and shown to have potent inhibitory effects on the activity of FAM84B.

Mouse monoclonal EXD1 antibody

The Human Growth Hormone antibody is a reactive monoclonal antibody that specifically targets and neutralizes the human serum albumin protein. This antibody has been extensively studied in the field of Life Sciences and has shown potential therapeutic applications. It can be used to inhibit the activity of growth hormone or other agonist proteins, making it an important tool for research and development.

Rabbit polyclonal SMARCC1 antibody

Mouse monoclonal EXOSC7 antibody

The CD70 antibody is a monoclonal antibody that targets the CD70 protein. It has been shown to inhibit the activity of phosphatase and nuclear factor kappa-light-chain-enhancer in B cells, leading to decreased polymerase activity and growth factor activation. This antibody also has cytotoxic effects on mycoplasma genitalium, as it activates endonuclease and caspase-9, resulting in cell death. The CD70 antibody is widely used in Life Sciences research and has potential applications in the development of targeted therapies for various diseases.

Rabbit polyclonal MYPT1 antibody (Thr696)

C12orf11 antibody was raised in Rabbit using Human C12orf11 as the immunogen

Rat monoclonal IL4 antibody (allophycocyanin)

CD4 antibody (PE) was raised in mouse using CD4+ transfectant/human CEM as the immunogen.

Rabbit polyclonal OR10J1 antibody

The EPHA5 antibody is a highly specialized antibody that targets the epidermal growth factor. It plays a crucial role in various Life Sciences applications, particularly in the study of adipose tissues. This antibody has been shown to affect important cellular processes such as glycosylation and cell adhesion through its interaction with proteins like E-cadherin and β-catenin.

Rat macrophage antibody (FITC) was raised in rabbit using rat macrophages as the immunogen.

Mouse monoclonal MAPK8 antibody

Rabbit polyclonal SCYL2 antibody

Rabbit polyclonal DFFA antibody

Rabbit polyclonal SLPI antibody (HRP)

Purified Rabbit polyclonal TUBGCP3 antibody

BCAP29 antibody was raised in Rabbit using Human BCAP29 as the immunogen

The AFP antibody is a specific antibody that targets alpha-fetoprotein (AFP), a protein that is often associated with certain types of cancer. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in cancer research. The AFP antibody works by binding to AFP and inhibiting its function, which can help prevent the growth and spread of cancer cells. It has been used in various research applications, including studies on the role of AFP in tumor development and progression. The AFP antibody is highly specific and can be used for detection purposes, such as in immunohistochemistry or ELISA assays. Its use in combination with other antibodies or techniques, such as saponin permeabilization or nuclear staining, allows for more comprehensive analysis of cellular processes involving AFP. Researchers and scientists rely on the AFP antibody to gain valuable insights into the mechanisms underlying cancer development and to develop potential therapeutic strategies targeting this protein.

The PSA antibody is a monoclonal antibody that specifically targets prostate-specific antigen (PSA). It is commonly used in medical research and diagnostics for the detection and quantification of PSA levels. This antibody has high specificity and sensitivity, making it a valuable tool in the diagnosis and monitoring of prostate cancer. The PSA antibody works by binding to PSA molecules, preventing their interaction with other proteins and inhibiting their activity. It can be used in various applications such as immunoassays, immunohistochemistry, and western blotting. The PSA antibody is nephrotoxicity-free and does not interfere with other cellular processes or pathways. With its exceptional performance and reliability, this antibody is an essential component in the field of life sciences and offers great potential for further advancements in prostate cancer research.

The USP10 antibody is a growth factor that belongs to the class of antibodies. It is specifically designed to target and neutralize dinitrophenyl (DNP) antigens. This monoclonal antibody has been extensively tested and validated for its high specificity and affinity towards DNP antigens. It can be used in various applications, including immunoassays, Western blotting, ELISA, and flow cytometry.

The MCL1 antibody is a highly specialized tool used in various assays and research applications. It is designed to specifically target and inhibit the activity of MCL1, a protein involved in cell survival and apoptosis regulation. This monoclonal antibody works by binding to MCL1 and neutralizing its function, allowing researchers to investigate its role in different cellular processes.

The SERP1 antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor epidermal growth factor (EGF). This antibody is derived from histidine-rich polyclonal antibodies, making it highly effective in inhibiting the activity of EGF. It specifically binds to EGF and prevents its interaction with cell surface receptors, thus blocking downstream signaling pathways involved in cell proliferation and survival.

KRT2A antibody was raised using the middle region of Krt2A corresponding to a region with amino acids EVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELN

The TAK1 antibody is a highly specialized growth factor protein used in Life Sciences research. It acts as an anti-MERTK antibody, targeting the MERTK receptor involved in cell signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. It specifically binds to transferrin and stimulates the growth of colonies of cells in vitro. The TAK1 antibody also plays a crucial role in regulating actin filaments and colony-stimulating factors. It is available as both polyclonal and monoclonal antibodies, providing researchers with versatile options for their experiments. Additionally, this antibody has shown potential effects on adipose tissue and steroid metabolism, as well as its interaction with transforming growth factor-beta 1 (TGF-β1).

The HER2 antibody is a monoclonal antibody that specifically targets the HER2 protein, which is overexpressed in certain types of cancer cells. This antibody inhibits the growth and proliferation of cancer cells by blocking the interaction between HER2 and other growth factors, such as epidermal growth factor and hepatocyte growth factor. Additionally, the HER2 antibody has been shown to have anti-angiogenic properties by inhibiting the production of vascular endothelial growth factor (VEGF) and VEGF-C, which are essential for the formation of new blood vessels. This antibody can be used as a targeted therapy for patients with HER2-positive cancers, such as breast and gastric cancer.

BIN2 antibody was raised in Rabbit using Human BIN2 as the immunogen

KIFAP3 antibody was raised in Rabbit using Human KIFAP3 as the immunogen

Rabbit polyclonal p47phox antibody (Ser359)

Mouse monoclonal CD95 Ligand antibody (PE)

Rabbit polyclonal SRFBP1 antibody