Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75562 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
GPD1L antibody
GPD1L antibody was raised using the middle region of GPD1L corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV
FOP antibody
FOP antibody was raised in Rat using Mouse Friend of Prmt1 N-terminus and GST fusion protein as the immunogen.UMPS antibody
UMPS antibody was raised using the C terminal of UMPS corresponding to a region with amino acids VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIILTA4H antibody
The LTA4H antibody is a highly specialized protein that plays a crucial role in various biological processes. This monoclonal antibody is widely used in Life Sciences research and has proven to be an invaluable tool for scientists studying tyrosine metabolism and related pathways.Adenosine A2a Receptor antibody
The Adenosine A2a Receptor antibody is a monoclonal antibody that targets the adenosine A2a receptor, a protein complex involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown potential as a growth factor and neuroprotective agent.
USP30 antibody
The USP30 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and neutralize the activity of USP30, an enzyme involved in cellular processes such as glucose-6-phosphate metabolism. This antibody has been extensively tested and proven to be highly effective in various assays and experimental setups.DCC antibody
DCC antibody was raised using the middle region of DCC corresponding to a region with amino acids PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQSAE1 antibody
The SAE1 antibody is a crucial tool in Life Sciences research. It is used to study various biological processes, including microvessel density, antigen-antibody reactions, and growth factors. The SAE1 antibody specifically targets nuclear β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody can be used in immunohistochemistry and Western blotting techniques to detect the presence and localization of β-catenin in different tissues and cell types. With its high specificity and sensitivity, the SAE1 antibody provides researchers with valuable insights into cellular processes and has become an essential component of many scientific studies. Whether you're studying collagen synthesis or investigating the role of β-catenin in disease progression, the SAE1 antibody is a reliable tool that will help you achieve accurate and reproducible results.CA 15-3 antibody
The CA 15-3 antibody is a highly effective tool for detecting and measuring the levels of CA 15-3 antigen in biological samples. This monoclonal antibody specifically targets the CA 15-3 antigen, which is a glycoprotein commonly found on the surface of breast cancer cells. By binding to this antigen, the CA 15-3 antibody enables researchers and clinicians to identify and monitor the progression of breast cancer.DNALI1 antibody
DNALI1 antibody was raised using the N terminal of DNALI1 corresponding to a region with amino acids MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKAHSV6 gp90 antibody
HSV6 gp90 antibody was raised in mouse using 90 KDa glycoprotein of HHV6 as the immunogen.ApoM antibody
ApoM antibody was raised in Mouse using a purified recombinant fragment of human ApoM expressed in E. coli as the immunogen.UBLCP1 antibody
UBLCP1 antibody was raised using the N terminal of UBLCP1 corresponding to a region with amino acids MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVDefensin beta 2 antibody
Defensin beta 2 antibody is a glycosylated monoclonal antibody that has neuroprotective properties. It belongs to the class of antibodies known as monoclonal antibodies, which are used in various fields such as Life Sciences and antiviral research. This antibody specifically targets defensin beta 2, a naturally occurring peptide involved in immune response and defense against pathogens.RIC8B antibody
RIC8B antibody was raised using a synthetic peptide corresponding to a region with amino acids HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL
