Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
TCL1A antibody
TCL1A antibody was raised using the N terminal of TCL1A corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLFOXA2 antibody
FOXA2 antibody is a monoclonal antibody that is widely used in Life Sciences research. It specifically targets the FOXA2 protein, which plays a crucial role in various cellular processes such as exocytosis and galactose metabolism. This antibody can be used for a variety of applications including immunohistochemistry, immunofluorescence, and western blotting. Additionally, it has been shown to have high specificity and sensitivity in detecting FOXA2 in various biological samples. The FOXA2 antibody is also commonly used in studies investigating the role of FOXA2 in nuclear organization, histone H3 modifications, and gene regulation. Its alkaline phosphatase conjugate allows for easy detection and visualization of the antigen of interest.AOX antibody
The AOX antibody is a monoclonal antibody that acts as an anticoagulant in human serum. It specifically targets and inhibits the activity of a glycoprotein involved in the coagulation process. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as an antiviral agent. Additionally, it has been found to have inhibitory effects on autoantibodies and can be used as a tool for research purposes. The AOX antibody also exhibits cytotoxic properties and has been investigated for its potential in treating leukemia. With its diverse range of applications, this antibody is a valuable asset in various scientific studies and medical research.Anti-HIV p24 antibody
The Anti-HIV p24 antibody is a monoclonal antibody that specifically targets the p24 protein of the Human Immunodeficiency Virus (HIV). It is widely used in Life Sciences research and diagnostics. The antibody has a high affinity for the p24 antigen and can effectively bind to it in various biological samples, such as human serum, blood plasma, and carcinoma cell lines. This monoclonal antibody is produced using hybridoma technology, ensuring its specificity and consistency. It recognizes the antigenic epitopes present on the p24 protein and neutralizes its activity. The Anti-HIV p24 antibody can be used in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry. In addition to its diagnostic applications, this antibody also has potential therapeutic uses. Its binding to the p24 protein inhibits viral replication and prevents the spread of HIV within the body. This makes it a valuable tool in HIV research and drug development. The Anti-HIV p
SHIP1 antibody
The SHIP1 antibody is a polyclonal antibody that belongs to the class of cytotoxic antibodies. It specifically targets the cysteine-rich protein SHIP1, which plays a crucial role in regulating various cellular processes in Life Sciences. By binding to SHIP1, this antibody acts as an inhibitor, preventing its interaction with other proteins and disrupting its normal function.BRCA1 antibody
The BRCA1 antibody is a highly specialized monoclonal antibody that targets the BRCA1 protein. This protein plays a crucial role in DNA repair and is associated with an increased risk of breast and ovarian cancer when mutated. The BRCA1 antibody specifically binds to the BRCA1 protein, allowing for its detection and analysis in various research applications.HNRPDL antibody
HNRPDL antibody was raised using the C terminal of HNRPDL corresponding to a region with amino acids YSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPYGLUR1 antibody
The GLUR1 antibody is a monoclonal antibody that belongs to the field of Life Sciences. It is specifically designed to neutralize the activity of GLUR1, a protein involved in various cellular processes. This antibody has a high affinity for GLUR1 and forms a stable complex through disulfide bonds. It can be used in research applications such as immunohistochemistry and western blotting to detect and quantify GLUR1 expression levels.VEGF antibody (biotin)
VEGF antibody (biotin) was raised in goat using highly pure recombinant human VEGF as the immunogen.Interferon gamma Antibody
The Interferon gamma Antibody is a powerful tool in the field of Life Sciences. This Monoclonal Antibody has been extensively studied for its anti-neoplastic properties and its ability to inhibit angiogenesis. It specifically targets interferon gamma, a cytokine that plays a critical role in immune response and inflammation.EGFR antibody
EGFR antibody was raised in mouse using recombinant human EGFR (424-605aa) purified from E. coli as the immunogen.AGXT antibody
AGXT antibody was raised in mouse using recombinant AGXT (330-392aa) purified from E. coli as the immunogen.IL1b antibody
IL1b antibody is a monoclonal antibody that specifically targets interleukin-1 beta (IL-1β), a pro-inflammatory cytokine involved in various biological processes. This antibody binds to IL-1β and inhibits its activity, making it useful for studying the role of IL-1β in different cellular and molecular pathways.C1ORF92 antibody
C1ORF92 antibody was raised using the middle region of C1Orf92 corresponding to a region with amino acids VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDATPTH antibody
The PTH antibody is a highly effective neutralizing agent that targets parathyroid hormone (PTH). It is commonly used in Life Sciences research to study the role of PTH in various biological processes. This monoclonal antibody specifically binds to PTH and inhibits its activity, making it an invaluable tool for studying the function of this growth factor.STAU1 antibody
STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKSATB1 antibody
The SATB1 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is specifically designed to target and neutralize the activity of SATB1, a protein involved in various cellular processes. This antibody has shown promising results in inhibiting the growth of cancer cells, including those derived from breast, lung, and colon cancers. In addition, it has been found to enhance the cytotoxic effects of chemotherapeutic agents such as trastuzumab and doxorubicin. The SATB1 antibody also exhibits neutralizing activity against epidermal growth factor (EGF) and transforming growth factor-beta (TGF-beta), further contributing to its anti-cancer properties. With its specificity and efficacy, this monoclonal antibody is a valuable tool in life sciences research and holds potential for the development of targeted therapies.SLC38A4 antibody
SLC38A4 antibody was raised using the middle region of SLC38A4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIVSF3B14 antibody
SF3B14 antibody was raised using the N terminal of SF3B14 corresponding to a region with amino acids MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVCaspase 9 antibody
The Caspase 9 antibody is a highly specific and reliable tool used in Life Sciences research. It is designed to detect and analyze caspase 9, an enzyme involved in programmed cell death (apoptosis). This antibody is derived from human serum and has been extensively tested for its accuracy and sensitivity.Raf1 antibody
The Raf1 antibody is a powerful tool in Life Sciences research. It is a polyclonal antibody that specifically targets the Raf1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used as a serum marker to detect the presence of Raf1 and study its expression levels in various cell types.STAT3 antibody
The STAT3 antibody is a powerful tool used in life sciences research. It specifically targets and binds to the STAT3 protein, which plays a crucial role in cellular signaling pathways. This antibody is particularly effective against Pseudomonas aeruginosa strains that are activated by growth factors and interleukin-6.
