Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
AMBP antibody
The AMBP antibody is a monoclonal antibody that targets the colony-stimulating factor and TNF-related apoptosis-inducing ligand (TRAIL). It acts as an inhibitor of these factors, preventing their activity and promoting cell survival. This antibody has been shown to have therapeutic potential in various life sciences applications, including cancer research and treatment. It has also been found to inhibit the growth of microvessels, which may be beneficial in controlling angiogenesis. Additionally, the AMBP antibody has demonstrated its efficacy in modulating immune responses by targeting TNF-α and fibrinogen. Its versatility and specificity make it a valuable tool for researchers in the field of immunology and molecular biology.CCDC128 antibody
CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENEHAND1 antibody
HAND1 antibody was raised in Mouse using a purified recombinant fragment of HAND1(aa90-190) expressed in E. coli as the immunogen.
DDX47 antibody
DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQCXCL5 antibody
The CXCL5 antibody is a monoclonal antibody that targets and neutralizes the activity of CXCL5, a growth factor involved in various biological processes. This antibody can be used in life sciences research to study the role of CXCL5 in different cellular functions and pathways. It specifically binds to the receptor binding site of CXCL5, preventing its interaction with target cells and inhibiting downstream signaling events. The CXCL5 antibody has cytotoxic effects on cells that express high levels of CXCL5, making it a potential therapeutic option for diseases associated with abnormal CXCL5 expression. Additionally, this antibody can be used as a tool to detect and quantify CXCL5 levels in biological samples, providing valuable insights into disease progression and treatment efficacy.Met antibody
The Met antibody is a monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor, also known as Met. This antibody has been shown to inhibit the activation of Met by HGF in human serum, making it a potential therapeutic option for diseases associated with aberrant Met signaling. The Met antibody specifically binds to the extracellular domain of the Met receptor, preventing its interaction with HGF and subsequent downstream signaling events. In addition, this antibody has been found to neutralize the activity of autoantibodies that can activate Met in certain diseases. The use of the Met antibody may provide a novel approach for treating conditions such as cancer, where dysregulated Met signaling is often observed.NGAL antibody
The NGAL antibody is a highly specialized binding protein that targets the necrosis factor-related apoptosis-inducing ligand (TRAIL) and alpha-fetoprotein (AFP). Developed by Life Sciences, this monoclonal antibody is designed to specifically bind to these target molecules in human serum. By binding to TRAIL and AFP, the NGAL antibody inhibits their protease activity and prevents their interaction with receptors on cell surfaces.
RBP4 antibody
The RBP4 antibody is a highly activated Monoclonal Antibody that has been specifically designed for use in various Life Sciences applications. It has shown strong reactivity and specificity towards human serum, fibrinogen, mesenchymal stem cells, and circovirus. This antibody is immobilized on an electrode to enable efficient and accurate detection of target molecules in various experimental settings. Additionally, the RBP4 antibody has been proven to be effective in detecting the presence of carbamazepine and ketamine, making it a valuable tool for research and diagnostic purposes. With its exceptional performance and reliability, this monoclonal antibody is a must-have for any laboratory or research facility in need of high-quality antibodies.PAK1 antibody
The PAK1 antibody is a highly specific monoclonal antibody that targets the p21-activated kinase 1 (PAK1) protein. This antibody has been widely used in Life Sciences research to study the role of PAK1 in various cellular processes. It can be used for applications such as Western blotting, immunohistochemistry, and immunofluorescence.Rubisco antibody
Rubisco antibody is a polyclonal antibody that specifically targets the rubisco enzyme. Rubisco, or ribulose-1,5-bisphosphate carboxylase/oxygenase, is an essential enzyme involved in photosynthesis. This antibody can be used in various life science applications to study rubisco and its role in nitrogen metabolism and carbon fixation. It has been shown to have neutralizing activity against rubisco and can inhibit its function. Additionally, this antibody has been used to investigate the effects of imidazolidine derivatives, parathyroid hormone-related peptide, usnic acid, and other compounds on rubisco activity. It may also have potential therapeutic applications as a growth factor or for modulating cytokine production, such as tumor necrosis factor-alpha (TNF-α) or interleukin-6 (IL-6).DDR1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive research, including using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.NPT antibody
NPT antibody was raised in Mouse using a purified recombinant fragment of NPT expressed in E. coli as the immunogen.Ferritin antibody
The Ferritin antibody is a monoclonal antibody that specifically targets spleen ferritin. It can be used in various applications, including immunohistochemistry, flow cytometry, and Western blotting. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting ferritin in human serum, rat liver microsomes, and viral membranes.GluR6 antibody
The GluR6 antibody is a highly specialized monoclonal antibody that plays a crucial role in the endocytic uptake of various growth factors, collagen, fatty acids, and low-density lipoproteins. This antibody acts as a neutralizing agent against specific receptors, preventing the activation of downstream signaling pathways. It has been extensively studied for its potential therapeutic applications in inhibiting cell proliferation and promoting apoptosis. Additionally, the GluR6 antibody has shown promising results in interfering with the glycation process and reducing inflammation associated with certain diseases. Whether used in research or clinical settings, this monoclonal antibody offers great potential for targeted therapy and further understanding of cellular mechanisms.STK3 antibody
STK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ
PFKP antibody
The PFKP antibody is a growth factor that interacts with annexin A2, a basic protein involved in cellular processes. This monoclonal antibody is designed to specifically target and bind to PFKP, inhibiting its activity. By blocking the function of PFKP, this antibody can potentially affect various cellular pathways, including fatty acid metabolism and epidermal growth factor signaling. The PFKP antibody has been extensively studied in the field of life sciences and has shown promising results in preclinical studies. Its specificity and high affinity make it an ideal tool for researchers studying PFKP-related mechanisms or developing therapeutic interventions targeting this protein.OTUB1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, confirming its high efficacy in humans.HK1 antibody
HK1 antibody was raised in Mouse using a purified recombinant fragment of human HK1 expressed in E. coli as the immunogen.Tropomodulin 3 antibody
Tropomodulin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDDLDPENALLPAGFRQKNQTSKSTTGPFDREHLLSYLEKEALEHKDREDUGP2 antibody
UGP2 antibody was raised using the N terminal of UGP2 corresponding to a region with amino acids TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN
PIP3-E antibody
PIP3-E antibody was raised using the middle region of PIP3-E corresponding to a region with amino acids IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE
