Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
RGR antibody
RGR antibody is a highly specialized antibody that targets the insulin-like growth factor-I (IGF-I). It belongs to the class of antibodies known as adeno-associated antibodies, which have been shown to have an inhibitory effect on adeno-associated viral (AAV) vectors. The RGR antibody specifically neutralizes the activity of CXCL13, a chemokine involved in various biological processes. In the field of Life Sciences, this antibody has demonstrated an anti-angiogenic effect by inhibiting blood vessel formation. Additionally, it has shown promise as a potential therapeutic agent for conditions such as fibrosis and cancer due to its anti-fibrotic properties and its ability to modulate the behavior of mesenchymal stem cells. The RGR antibody is widely used in research and is available as a polyclonal antibody, making it a valuable tool for scientists studying IGF-I-related pathways.ASC antibody
The ASC antibody is a powerful tool in the field of Life Sciences. It specifically targets antibody-secreting cells (ASCs) and can be used to detect and study various types of antibodies. This antibody is effective in detecting both monoclonal and polyclonal antibodies, making it versatile for different research applications. The ASC antibody has been extensively tested and validated for its specificity and sensitivity. It can be used in various techniques such as fluorescent assays, flow cytometry analysis, and protein complex studies. Additionally, this antibody has been shown to have opsonophagocytic activity, which makes it an excellent choice for studying immune responses. With its high-quality performance and reliable results, the ASC antibody is a valuable asset for researchers in the field of immunology and antibody research.SIX4 antibody
The SIX4 antibody is a protein that belongs to the group of polyclonal antibodies. It acts as a growth factor and colony-stimulating factor, promoting cell growth and proliferation. The antibody also exhibits phosphatase activity, which is important for regulating cellular processes. Additionally, it interacts with fibrinogen, adalimumab, and TNF-α (tumor necrosis factor-alpha), potentially influencing apoptosis-inducing pathways. This monoclonal antibody can inhibit protein kinase activity and has been shown to affect microvessel density. It may have implications in TNF-related apoptosis-inducing signaling pathways.Cathepsin D antibody
The Cathepsin D antibody is a highly specific monoclonal antibody that targets the human enzyme Cathepsin D. This antibody has been extensively studied and proven to be an effective serum marker for various diseases and conditions. Immunocytochemical studies have shown that this antibody can accurately detect the presence of Cathepsin D in lymphocyte cultures, making it a valuable tool for research and diagnostic purposes.RAI14 antibody
RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAEDC9ORF127 antibody
C9ORF127 antibody was raised using the middle region of C9Orf127 corresponding to a region with amino acids THNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVAdiponectin antibody
Adiponectin antibody was raised in mouse using recombinant human adiponectin (15-244aa) purified from E. coli as the immunogen.NF1 antibody
The NF1 antibody is a polyclonal antibody that specifically targets the NF1 protein. This protein plays a crucial role in regulating cell growth and division, as well as in controlling the development of tumors. The NF1 antibody is widely used in life sciences research to study the function and activity of the NF1 protein.
CYP3A4 antibody
The CYP3A4 antibody is a specific antibody used in Life Sciences research. It plays a crucial role in the metabolism of various drugs and toxins in the body. This cholinergic antibody targets the cytochrome P450 enzyme CYP3A4, which is primarily found in liver microsomes. By inhibiting the activity of CYP3A4, this antibody can help researchers understand the effects of drug interactions and develop more effective treatments.RAD51AP1 antibody
RAD51AP1 antibody was raised using the middle region of RAD51AP1 corresponding to a region with amino acids IKKKEVKVKSPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVSLATG4A antibody
ATG4A antibody was raised using a synthetic peptide corresponding to a region with amino acids DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRAdenovirus antibody
Adenovirus antibody was raised in mouse using hexon antigen of human adenovirus as the immunogen.TEL antibody
TEL antibody is a monoclonal antibody that specifically targets the TEL protein. This protein plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The TEL antibody has been extensively studied for its potential therapeutic applications in cancer treatment.C7ORF31 antibody
C7ORF31 antibody was raised using the N terminal Of C7Orf31 corresponding to a region with amino acids EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRECeruloplasmin antibody
The Ceruloplasmin antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to ceruloplasmin, a protein found in human serum. This antibody recognizes the carbonyl group and amino group of ceruloplasmin, making it an essential tool for research on this protein.ETFB antibody
ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP
WDR21B antibody
WDR21B antibody was raised using the middle region of WDR21B corresponding to a region with amino acids HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRLNDRG2 antibody
NDRG2 antibody was raised using the C terminal of NDRG2 corresponding to a region with amino acids GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG
CK2A1 antibody
The CK2A1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize glucose-6-phosphate, sclerostin, and other EGF-like proteins. This monoclonal antibody has been extensively tested and validated for its efficacy in various assays. The CK2A1 antibody is produced using state-of-the-art technology and quality control measures to ensure its purity and specificity. It is commonly used by researchers and scientists to study the role of these proteins in various biological processes. With its high affinity and specificity, the CK2A1 antibody is an essential tool for anyone working in the field of molecular biology or protein research.
