Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Synaptojanin 2 antibody
Synaptojanin 2 antibody was raised using the N terminal of SYNJ2 corresponding to a region with amino acids SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIALASB7 antibody
ASB7 antibody was raised using the middle region of ASB7 corresponding to a region with amino acids QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPCYTHDF1 antibody
YTHDF1 antibody was raised using the middle region of YTHDF1 corresponding to a region with amino acids QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAMOTL1 antibody
AMOTL1 antibody was raised using the N terminal of AMOTL1 corresponding to a region with amino acids LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEEhCG Beta antibody
The hCG Beta antibody is a highly specific monoclonal antibody that targets the beta subunit of human chorionic gonadotropin (hCG). It is widely used in Life Sciences research for various applications, including immunoassays and immunohistochemistry.Chlorpyrifos antibody
The Chlorpyrifos antibody is a monoclonal antibody produced by a hybridoma cell line. It is designed to specifically bind to chlorpyrifos, an organophosphate insecticide commonly used in agriculture. This antibody can be used for various applications in the field of Life Sciences, including immunoassays and research studies.MMP9 antibody
MMP9 antibody was raised in mouse using a synthetic peptide corresponding to amino acid 626-644 of human MMP9 as the immunogen.
Ferritin antibody
The Ferritin antibody is a powerful tool used in the field of Life Sciences. This monoclonal antibody specifically targets ferritin, a protein responsible for storing iron in cells. By binding to ferritin, this antibody can be activated to perform various functions.RAD23B antibody
RAD23B antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGNIP7 antibody
NIP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTSNF1LK antibody
SNF1LK antibody was raised using the N terminal of SNF1LK corresponding to a region with amino acids MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKLipocalin 1 antibody
Lipocalin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGDegré de pureté :Min. 95%BOLL antibody
BOLL antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ
APEH antibody
APEH antibody was raised using the middle region of APEH corresponding to a region with amino acids GSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSHGADL1 antibody
GADL1 antibody was raised using the middle region of GADL1 corresponding to a region with amino acids SAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGARNF146 antibody
RNF146 antibody was raised using the C terminal of RNF146 corresponding to a region with amino acids AVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRPKeratin K7 antibody
Keratin K7 antibody was raised in mouse using Cytoskeletal proteins from cultured HeLa cells as the immunogen.P53 antibody
The P53 antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets the P53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody has been extensively tested and validated for its high specificity and sensitivity.TGF beta 1 antibody
The TGF beta 1 antibody is a powerful tool in Life Sciences research. It specifically targets and neutralizes TGF-beta, an endonuclease that plays a crucial role in various cellular processes. This polyclonal antibody binds to the amino-terminal region of TGF-beta 1, preventing its interaction with receptors and subsequent downstream signaling events.KCNK13 antibody
KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNOL6 antibody
NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG
KDM5B antibody
The KDM5B antibody is a monoclonal antibody that targets the protein KDM5B. This protein plays a crucial role in regulating gene expression by modifying histone proteins through processes such as acetylation and phosphorylation. The KDM5B antibody specifically recognizes and binds to KDM5B, allowing for the detection and analysis of this protein in various biological samples.
