Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
GNB1 antibody
GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADC4ORF22 antibody
C4ORF22 antibody was raised using the N terminal Of C4Orf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT
Osteopontin antibody
The Osteopontin antibody is a glycoprotein that has cytotoxic effects and interferes with the function of serine protease inhibitors. It is a type of monoclonal antibody that specifically targets osteopontin, a protein involved in various biological processes. This antibody has been shown to neutralize the activity of osteopontin, inhibiting its function and potentially preventing its involvement in disease progression. The Osteopontin antibody is commonly used in life sciences research and has shown promising results in studies related to cancer, inflammation, and other pathological conditions. With its ability to target specific molecules, this antibody offers great potential for therapeutic applications in the future.Giardia lamblia antibody
Giardia lamblia antibody is a monoclonal antibody that specifically targets and activates the immune response against Giardia lamblia, a parasite that causes gastrointestinal infections. This antibody binds to specific proteins expressed by the parasite, such as alpha-fetoprotein and β-catenin, preventing their function and inhibiting the growth and survival of Giardia lamblia. The use of this antibody in Life Sciences research has provided valuable insights into the mechanisms of host-parasite interactions and has led to the development of potential antiviral therapies. The formulation of this antibody includes excipients and polymers that enhance stability and prolong its shelf life. It can be used in various laboratory techniques, including immunoassays, immunofluorescence, and Western blotting, for the detection and quantification of Giardia lamblia in clinical samples.Forssman antigen antibody
The Forssman antigen antibody is a powerful biomolecule used in Life Sciences research. It exhibits protease activity and plays a crucial role in various biological processes. This monoclonal antibody targets the Forssman antigen, a glycoconjugate that is activated in response to certain stimuli. The Forssman antigen antibody has been extensively studied for its ability to neutralize the effects of the Forssman antigen and inhibit its binding to other proteins and cells. It has also shown potential as a therapeutic agent for autoimmune disorders, as it can interfere with the production of autoantibodies. Additionally, this antibody has been found to modulate the activity of growth factors and interferons, further highlighting its versatility in molecular biology research. With high bioavailability and specificity, the Forssman antigen antibody is an essential tool for scientists studying protein isoforms and exploring new avenues in immunology and biotechnology.Gamma synuclein antibody
The Gamma synuclein antibody is a monoclonal antibody used in Life Sciences research. It specifically targets gamma synuclein, a protein that plays a role in cellular processes related to reactive oxygen species and apoptosis. The antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence of gamma synuclein in tissues and cells. Additionally, this antibody has been shown to have neuroprotective properties and may be useful in studying the effects of cytotoxic drugs on neuronal cells. Its high specificity and sensitivity make it an excellent tool for researchers studying the function and regulation of gamma synuclein.EpCAM antibody
EpCAM antibody was raised in mouse using HT-29 colon carcinoma cell line as the immunogen.FkBP4 antibody
FkBP4 antibody was raised in mouse using recombinant human FkBP4 (1-459aa) purified from E. coli as the immunogen.
His Tag antibody
The His Tag antibody is a monoclonal antibody that specifically binds to proteins containing a histidine (His) tag. This antibody has been widely used in Life Sciences research for the detection and purification of recombinant proteins. The His Tag antibody recognizes the His tag sequence, which is commonly added to proteins during recombinant protein expression. This antibody can be used in various applications such as Western blotting, immunoprecipitation, and immunofluorescence. It has been shown to have high specificity and sensitivity in detecting His-tagged proteins. The His Tag antibody has been extensively validated and is suitable for use in both basic research and commercial applications.ZFP36 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity and is widely used in the treatment of tuberculosis infections. This active compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. The effectiveness of this drug has been demonstrated through various scientific techniques such as transcription-quantitative polymerase chain and patch-clamp technique. It undergoes several metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
TMED3 antibody
TMED3 antibody was raised using the C terminal of TMED3 corresponding to a region with amino acids DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHSTRIB2 antibody
The TRIB2 antibody is a monoclonal antibody that is commonly used in Life Sciences research. It specifically targets the TRIB2 protein, which plays a crucial role in various cellular processes such as growth factor signaling and cell proliferation. This antibody has been extensively validated for applications such as immunohistochemistry, western blotting, and flow cytometry.PSCA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
WNT3 antibody
The WNT3 antibody is a growth factor medicament that is used in biochemical research and Life Sciences. It is a monoclonal antibody that specifically targets and binds to the activated form of WNT3, a crucial signaling molecule involved in various cellular processes. This antibody is commonly used in experiments to study the role of WNT3 in development, tissue regeneration, and disease progression.MYBL2 antibody
MYBL2 antibody was raised in mouse using recombinant V-Myb Myeloblastosis Viral Oncogene Homolog (Avian)-Like 2 (Mybl2)TNFR2 antibody
TNFR2 antibody is a monoclonal antibody that specifically targets the tumor necrosis factor receptor 2 (TNFR2). It has been widely used in life sciences research to study the role of TNFR2 in various biological processes. This antibody binds to the amino-terminal region of TNFR2 and can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting. TNFR2 antibody has been shown to have inhibitory effects on the activation of cardiomyocytes and the production of chemokines. It can also neutralize the activity of TNF-α, a pro-inflammatory cytokine. Additionally, this antibody has been used in studies investigating the natriuretic and anti-apoptotic effects of TNFR2 signaling. With its high specificity and affinity, TNFR2 antibody is a valuable tool for researchers studying TNFR2-related pathways and functions.FOXN2 antibody
FOXN2 antibody is a highly specific monoclonal antibody that targets the tyrosine kinase receptor FOXN2. This nuclear growth factor plays a crucial role in various cellular processes, including collagen synthesis and cell proliferation. The FOXN2 antibody is widely used in Life Sciences research to study the signaling pathways regulated by this receptor.CBR1 antibody
The CBR1 antibody is a neuroprotective agent that binds to specific proteins in the body. It acts by neutralizing certain inhibitors and promoting the health of nerve cells. This antibody is widely used in Life Sciences research and has been developed as a monoclonal antibody. It can be used in various applications, such as electrode-based assays or interferon detection. The CBR1 antibody has also shown promising results in studies involving human serum and mesenchymal stem cells. Its multidrug binding capabilities make it a valuable tool for researchers working with antibodies.FBXO25 antibody
FBXO25 antibody was raised using the N terminal of FBXO25 corresponding to a region with amino acids LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL
C3ORF10 antibody
C3ORF10 antibody was raised using the middle region of C3Orf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
