Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
DUS1L antibody
DUS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF
FYTTD1 antibody
FYTTD1 antibody was raised in rabbit using the middle region of FYTTD1 as the immunogenNARG1 antibody
NARG1 antibody was raised in mouse using recombinant Human Nmda Receptor Regulated 1 (Narg1)CD51 antibody
The CD51 antibody is a highly specific monoclonal antibody that can be used for ultrasensitive detection of protease activity. It is commonly used in Life Sciences research, particularly in flow immunoassays and electrode-based assays. This antibody binds to CD51, a surface protein expressed on human cells, and neutralizes its function. The CD51 antibody has been extensively validated and shown to provide accurate and reliable results in various experimental settings. Its high affinity and specificity make it an ideal tool for studying protease activity and its role in various biological processes. Additionally, the CD51 antibody can be easily modified for surface immobilization using techniques such as collagenase treatment or surface modification for electrochemical impedance spectroscopy. With its exceptional sensitivity and versatility, the CD51 antibody is a valuable asset in any research laboratory seeking to investigate protease activity with precision and accuracy.IL1F10 antibody
IL1F10 antibody was raised in rabbit using the middle region of IL1F10 as the immunogenGRIK2 antibody
GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPIRF3 antibody
The IRF3 antibody is a highly specialized monoclonal antibody used in Life Sciences. It is specifically designed to target and bind to the nuclear protein IRF3, which plays a crucial role in regulating the immune response. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.BSG antibody
The BSG antibody is a highly specialized product in the field of Life Sciences. It is an antiviral monoclonal antibody that specifically targets and neutralizes the activated glycoprotein known as BSG (Basigin). This monoclonal antibody has been extensively studied and proven to have high affinity and specificity for BSG.HSV1 gG antibody
HSV1 gG antibody was raised in mouse using herpes simplex type 1 gG as the immunogen.AIM2 antibody
AIM2 antibody is a cytotoxic monoclonal antibody that targets the AIM2 protein. The AIM2 protein is involved in the regulation of cell growth and proliferation, specifically in the interaction between hyaluronic acid and epidermal growth factor receptors. This antibody can be used in various life science applications, including research, diagnostics, and therapeutic development.CD29 antibody
CD29 antibody was raised in mouse using recombinant human CD29 (34-141aa) purified from E. coli as the immunogen.S100B antibody
The S100B antibody is an acidic monoclonal antibody that acts as an inhibitor of various proteins and enzymes. It has been shown to inhibit the activity of liver microsomes, oncostatin, and histone H3 in Life Sciences research. This antibody specifically targets the S100B antigen and has been found to modulate dopamine and tyrosine metabolism. Additionally, it has been shown to affect the expression of β-catenin and exhibit anti-glial fibrillary properties. The S100B antibody is a valuable tool in research and diagnostics for studying various cellular processes and pathways involving these proteins.PLK1 antibody
The PLK1 antibody is a monoclonal antibody that targets the amino-terminal region of PLK1, a protein involved in various cellular processes. This antibody is widely used in life sciences research to study the role of PLK1 in cell growth and division. It has been shown to inhibit the activity of PLK1, leading to reduced proliferation and increased apoptosis in cancer cells. Additionally, this antibody has been found to decrease microvessel density and inhibit angiogenesis, making it a potential therapeutic target for cancer treatment. The PLK1 antibody has high affinity and specificity for its target, ensuring accurate and reliable results in experiments. It can be used in various techniques such as immunohistochemistry, Western blotting, and flow cytometry. With its ability to neutralize PLK1 activity, this antibody holds great promise for advancing our understanding of cellular processes and developing novel therapeutic strategies.Peptidase D antibody
Peptidase D antibody was raised using the middle region of PEPD corresponding to a region with amino acids LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVMIF4GD antibody
MIF4GD antibody was raised using the C terminal of MIF4GD corresponding to a region with amino acids LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSDRON antibody
The RON antibody is a polyclonal antibody that targets the growth factor receptor known as RON. It is also available in monoclonal form. This antibody binds to RON and can be used for various applications, including research and diagnostic purposes. RON is a receptor tyrosine kinase that plays a role in cell proliferation, migration, and survival. The binding of the RON antibody to this receptor can inhibit its activity, making it useful for studying the function of RON and its signaling pathways. Additionally, the RON antibody can be used as a therapeutic agent by blocking the interaction between RON and its ligands, potentially preventing or treating diseases associated with aberrant RON signaling.HRS antibody
The HRS antibody is a highly specialized product in the field of Life Sciences. It is widely used in research and diagnostic applications. This antibody is produced using mass spectrometric methods, ensuring its purity and quality.SERPINB5 antibody
SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM
