Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75602 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
FLYWCH1 antibody
FLYWCH1 antibody was raised in rabbit using the middle region of FLYWCH1 as the immunogenCDK2 antibody
The CDK2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is commonly used for the detection and analysis of cyclin-dependent kinase 2 (CDK2) activity. The antibody is immobilized on a microsphere or electrode surface, allowing for easy and efficient binding to its target protein.Gram Negative Endotoxin antibody
Gram negative endotoxin antibody was raised in mouse using E. coli J5 whole cells as the immunogen.CYLC2 antibody
CYLC2 antibody was raised using the C terminal of CYLC2 corresponding to a region with amino acids DAKKVAKKDTEKESADSKKDAKKNAKKDAKKDAKKNAKKDEKKDAKKKGKNGAL antibody
The NGAL antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to NGAL (Neutrophil Gelatinase-Associated Lipocalin), a protein involved in various biological processes. This antibody has been extensively studied and proven effective in immunohistochemistry, where it is used to detect the presence and localization of NGAL in tissues.
STIP1 antibody
STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMTP53INP1 antibody
The TP53INP1 antibody is a highly effective medicament in the field of Life Sciences. It belongs to the class of anti-HER2 antibodies and is commonly used in combination with trastuzumab for targeted therapy. This antibody specifically targets the TP53INP1 protein, which plays a crucial role in regulating cell growth and division.DTNB antibody
The DTNB antibody is a specialized antibody that is used in the field of life sciences. It specifically targets cholinesterase, an enzyme that plays a crucial role in the breakdown of carbamate pesticides and organophosphorus compounds. This antibody can be used for research purposes to study the effects of these compounds on cholinesterase activity. It is also useful for developing diagnostic tests to detect exposure to carbamate pesticides or organophosphorus compounds. The DTNB antibody is a monoclonal antibody, which means it is highly specific and effective in detecting its target molecule. Its use in various applications makes it an essential tool for researchers and professionals working in the field of life sciences.Horse RBC antibody (FITC)
Horse RBC antibody (FITC) was raised in rabbit using eqiune erythrocytes as the immunogen.SYP antibody
SYP antibody was raised in Mouse using a purified recombinant fragment of SYP expressed in E. coli as the immunogen.Tau antibody
The Tau antibody is a monoclonal antibody that targets sclerostin, a protein involved in bone formation. This antibody has been widely used in Life Sciences research to study the role of sclerostin in various biological processes. It can be used in experiments such as Western blotting, immunohistochemistry, and ELISA to detect and quantify sclerostin levels in different samples.WDR51B antibody
WDR51B antibody was raised using the N terminal of WDR51B corresponding to a region with amino acids GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASPSTAIR antibody
The PSTAIR antibody is a highly versatile and potent tool in the field of Life Sciences. This monoclonal antibody has been extensively studied and proven to have a wide range of applications. It has shown exceptional binding affinity to various targets, including growth factors, influenza hemagglutinin, collagen, alpha-fetoprotein, fibrinogen, and many more.anti-Human IgG Fc Antibody (Goat) - HRP Conjugated
HRP Conjugated Goat anti-Human IgG Fc AntibodyDegré de pureté :Min. 95%SSB antibody
The SSB antibody is a highly specific monoclonal antibody that targets and binds to the SSB protein. This antibody has cytotoxic effects on cancer cells, making it a valuable tool in cancer research and treatment. It has been shown to induce apoptosis in cardiomyocytes and inhibit the activation of β-catenin, a key regulator of cell proliferation and differentiation. The SSB antibody also reacts with pancreatic glucagon-producing cells, making it useful for studying pancreatic function and diabetes. Additionally, this antibody can be used in diagnostic tests to detect autoantibodies associated with certain autoimmune diseases. With its high specificity and versatility, the SSB antibody is an essential tool for researchers in the life sciences field.HSD17B14 antibody
HSD17B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD
Myeloperoxidase antibody
The Myeloperoxidase antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to myeloperoxidase, an enzyme found in abundance in neutrophils and monocytes. By binding to myeloperoxidase, this antibody can be used for a variety of applications including immunohistochemistry, flow cytometry, and Western blotting.CAS antibody
CAS antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It is colloidal in nature and has been proven to be effective in detecting microvessel density. This antibody specifically targets tumor necrosis factor-alpha (TNF-α) and can be used for various applications, such as immunohistochemistry and Western blotting. CAS antibody also has the ability to bind to mimetic peptides and nuclear proteins, making it a versatile tool for research purposes. Additionally, this antibody can be used as a cross-linking agent in polymerase chain reactions (PCR) and has been shown to activate vascular endothelial growth factor-C (VEGF-C), which plays a crucial role in angiogenesis. With its high specificity and reliability, CAS antibody is an essential component for any laboratory studying cellular processes and protein interactions.CENPH antibody
CENPH antibody was raised using the middle region of CENPH corresponding to a region with amino acids ESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERI
Degré de pureté :Min. 95%CDH16 antibody
The CDH16 antibody is a polyclonal antibody that is highly effective in targeting specific proteins involved in various cellular processes. This antibody has cytotoxic properties and has been shown to inhibit the growth of cancer cells by targeting c-myc, insulin, erythropoietin, and anti-VEGF. It can be used in a variety of assays and research applications in the field of Life Sciences. The CDH16 antibody specifically targets growth factors and endothelial growth, making it an essential tool for studying cellular pathways and identifying potential therapeutic targets.F(ab')2 Affinity Purified Goat anti-Human IgG, IgM, IgA
Affinity Purified Goat anti-Mouse IgG, IgM, IgA minimal reactivity with Human
Degré de pureté :Min. 95%
