Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75602 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
RREB1 antibody
The RREB1 antibody is a powerful tool used in Life Sciences for various applications. This antibody specifically targets the RREB1 protein, which plays a crucial role in regulating gene expression and cellular processes. By binding to RREB1, this antibody can be used to study its function and activity in different biological systems.CK2 alpha 1 antibody
CK2 alpha 1 antibody was raised using the middle region of CSNK2A1 corresponding to a region with amino acids LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPPUF60 antibody
The PUF60 antibody is a polyunsaturated polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and bind to the PUF60 protein, which plays a crucial role in various cellular processes such as glucagon and chemokine signaling. This antibody has been extensively tested and validated for its reactivity against a wide range of test substances including mda-mb-231 cells, reactive polymers, oligodeoxynucleotides, and more. The PUF60 antibody is highly specific and exhibits strong binding affinity, making it an ideal tool for various applications such as immunohistochemistry, Western blotting, chromatographic techniques, and electrophoresis. Whether you are conducting research or developing new therapeutics, this high-quality monoclonal antibody will provide accurate and reliable results.LTA4H antibody
The LTA4H antibody is a monoclonal antibody that specifically targets the LTA4H protein. This protein plays a crucial role in various biological processes, including inflammation and immune response. The LTA4H antibody has been extensively studied for its potential therapeutic applications in diseases such as cancer, autoimmune disorders, and neurodegenerative diseases.EML3 antibody
EML3 antibody was raised using the N terminal of EML3 corresponding to a region with amino acids LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYIRRP9 antibody
RRP9 antibody was raised using the middle region of RRP9 corresponding to a region with amino acids IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQHSSB antibody
The SSB antibody is a monoclonal antibody that specifically targets the SSB protein. This protein plays a crucial role in various cellular processes, including DNA replication and repair. The SSB antibody binds to the SSB protein, preventing its interaction with other molecules such as collagen and actin filaments.Fibronectin antibody
The Fibronectin antibody is a specific antibody used in Life Sciences research. It is a monoclonal antibody that specifically targets fibronectin, a protein involved in cell adhesion and migration. This antibody can be used for various applications, such as immunohistochemistry, Western blotting, and flow cytometry. The Fibronectin antibody has been extensively validated and is highly specific, ensuring accurate and reliable results in your experiments. It is supplied in a buffered solution for easy handling and storage. Whether you are studying cell signaling pathways, growth factors, or collagen deposition, the Fibronectin antibody is an essential tool for your research. Trust this high-quality antibody to provide accurate and reproducible results in your immunoassays.
IL9 antibody
The IL9 antibody is a polyclonal antibody used in Life Sciences research. It specifically binds to IL9, a cytokine that plays a crucial role in immune response and allergic reactions. The IL9 antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays. It has been shown to neutralize the activity of IL9 by blocking its binding to its receptor. This antibody can be used to study the function of IL9 in different biological processes and may have potential therapeutic applications in diseases involving abnormal IL9 signaling.SHC1 antibody
The SHC1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the SHC1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used to study the function of SHC1 and its involvement in various biological processes.Raf1 antibody
The Raf1 antibody is a cytotoxic monoclonal antibody that targets the Raf1 protein, a key component of the MAPK signaling pathway. This antibody specifically binds to tyrosine-phosphorylated Raf1 and inhibits its activity, leading to the suppression of downstream signaling events. The Raf1 antibody has been extensively used in research studies to investigate the role of Raf1 in various cellular processes, such as cell proliferation, differentiation, and survival. It is commonly used in techniques like immunohistochemistry and Western blotting to detect the expression and activation status of Raf1 in different tissues and cell types. Additionally, this antibody has been employed in drug development efforts to test the efficacy of Raf1 inhibitors as potential cancer therapeutics. Its high specificity and sensitivity make it an invaluable tool for scientists working in the field of Life Sciences who aim to understand the complex mechanisms underlying cellular function and disease progression.Arrestin B2 antibody
Arrestin B2 antibody was raised using the middle region of ARRB2 corresponding to a region with amino acids RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLANP32E antibody
ANP32E antibody was raised using a synthetic peptide corresponding to a region with amino acids EDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDECTLA4 antibody
CTLA4 antibody is a protein that targets the CTLA-4 receptor, which plays a crucial role in regulating immune responses. This antibody binds to CTLA-4 and blocks its interaction with B7 ligands, thereby enhancing T-cell activation and promoting anti-tumor immune responses. It has been shown to inhibit the growth of various types of tumors and is currently being used in cancer immunotherapy. Additionally, CTLA4 antibody has also been studied for its potential in treating autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. With its ability to modulate immune responses, this antibody holds great promise in the field of immunology and offers new avenues for therapeutic interventions.Alpha-1-microglobulin monoclonal antibody
Mouse anti-Human Alpha-1-microglobulin protein monoclonal antibodyRNF6 antibody
RNF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSERAPSN antibody
RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVBRS3 antibody
The BRS3 antibody is a nuclear antibody that is used in Life Sciences for various applications. It can be used as a test compound or inhibitor in research studies. This antibody specifically targets BRS3, a receptor protein involved in various physiological processes. The BRS3 antibody is highly specific and has been solubilized for easy use in different assays. It can be used as an affinity ligand to isolate and purify BRS3 or as a tool to detect the presence of BRS3 in samples. This polyclonal antibody is produced using advanced techniques and has been validated for its performance and reliability. Whether you are studying autoantibodies or investigating the role of BRS3 in diseases, the BRS3 antibody is an essential tool for your research needs.TOLLIP antibody
The TOLLIP antibody is a highly specialized solution used in the field of Life Sciences. It is designed to target and react with Toll-interacting protein (TOLLIP), an important protein involved in various cellular processes. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs.ARL11 antibody
ARL11 antibody was raised using the middle region of ARL11 corresponding to a region with amino acids WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKMSI2 antibody
The MSI2 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets α-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. The MSI2 antibody has been shown to effectively detect and quantify α-synuclein in various biological samples, including blood plasma and brain tissue. It can be used for immunohistochemistry, immunofluorescence, and Western blotting techniques. Additionally, the MSI2 antibody is highly specific and exhibits low cross-reactivity with other proteins, ensuring accurate results. Its cytotoxic properties make it an ideal tool for studying the role of α-synuclein in disease progression and developing potential therapeutic interventions. With its reliable performance and versatility, the MSI2 antibody is an essential component of any research project focused on understanding neurodegenerative disorders.
