Anticorps primaires

ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL

CHRFAM7A antibody was raised using the N terminal of CHRFAM7A corresponding to a region with amino acids QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC

SLC17A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS

PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV

LDLRAD3 antibody is a polyclonal antibody that is commonly used in life sciences research. It is highly specific and sensitive, making it an ideal tool for various applications. This antibody can be used for immunohistochemistry, Western blotting, ELISA, and other assays to detect the presence of LDLRAD3 protein in samples. The antibody has been validated using sodium citrate-activated antigen retrieval and has shown excellent performance in detecting LDLRAD3 in various tissues. Additionally, this antibody can be used as a primary or secondary antibody when combined with other antibodies to study protein-protein interactions or signaling pathways. Its high affinity and specificity make it a valuable tool for researchers studying growth factors, protein kinases, nuclear proteins, and inhibitors. With its versatility and reliability, the LDLRAD3 antibody is an essential component of any laboratory involved in life sciences research.

HAP40 antibody was raised in rabbit using residues 314-325 [DGHGQDTSGQLP] of the 40 kDa mouse HAP40 protein as the immunogen.

The ATF4 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and neutralizes the activity of ATF4, a transcription factor that plays a crucial role in cellular responses to stress and growth factor signaling. This antibody is designed to bind to ATF4 dimers, preventing their interaction with DNA and inhibiting the expression of target genes involved in processes such as collagen synthesis and hepatocyte growth. The ATF4 antibody is widely used in various applications, including immunohistochemistry, Western blotting, and chromatin immunoprecipitation. With its high specificity and cytotoxic properties, this antibody is an essential tool for studying the molecular mechanisms underlying cellular stress responses and identifying potential therapeutic targets for various diseases.

Atg12 antibody was raised in rabbit using the C terminal of Atg12 as the immunogen

MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD

USP17L2 antibody was raised in rabbit using the middle region of USP17L2 as the immunogen

PDK1 antibody was raised using the middle region of PDK1 corresponding to a region with amino acids ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY

RMI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA

EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI