Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
75602 produits trouvés pour "Anticorps primaires"
RCHY1 antibody
RCHY1 antibody was raised using the N terminal of RCHY1 corresponding to a region with amino acids KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYCDC6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. In addition, it has been proven to have a high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.
RTN3 antibody
The RTN3 antibody is a powerful tool in the field of anti-angiogenesis. It acts as an inhibitor, making it ideal for both treatment and prophylaxis purposes. This antibody is available in both polyclonal and monoclonal forms, providing flexibility for different research needs.GPR87 antibody
GPR87 antibody was raised using the middle region of GPR87 corresponding to a region with amino acids NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITLASL antibody
ASL antibody was raised using the N terminal of ASL corresponding to a region with amino acids GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAEAPPBP2 antibody
APPBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLNKRT14 antibody
The KRT14 antibody is a growth factor that plays a crucial role in various biological processes. It is an autoantibody that specifically targets and activates KRT14, which is a multidrug resistance protein. This antibody has shown promising results in combination with other therapies such as trastuzumab, leading to increased efficacy in the treatment of certain cancers. Additionally, the KRT14 antibody has been found to reduce viscosity and enhance drug delivery due to its ability to bind to amino groups and inhibit interleukin-6 activity. This monoclonal antibody offers a targeted approach for treating diseases associated with KRT14 dysregulation, making it a valuable tool in medical research and therapy development.ACTB antibody
The ACTB antibody is a highly specialized monoclonal antibody that targets the ACTB protein. This protein plays a crucial role in various biological processes, including cell structure and movement. The ACTB antibody specifically recognizes and binds to the ACTB protein, allowing for its detection and analysis in various experimental settings.BLM antibody
The BLM antibody is a monoclonal antibody that is widely used in Life Sciences research. It has the ability to lyse cells and neutralize the effects of certain proteins, such as collagen and tumor necrosis factor-alpha (TNF-α). This antibody can also be used to study the role of growth factors and other antibodies, such as polyclonal antibodies, trastuzumab, and adalimumab. Additionally, it has been shown to interact with various molecules, including TGF-beta, chemokines, and epidermal growth factors. The BLM antibody is a valuable tool for researchers in various fields who are interested in studying protein interactions and their effects on cellular processes.BMP4 antibody
BMP4 antibody was raised in Mouse using a purified recombinant fragment of human BMP4 expressed in E. coli as the immunogen.HER3 antibody
The HER3 antibody is a monoclonal antibody known as trastuzumab, which belongs to the class of multidrug antibodies. It specifically targets and inhibits the growth factor receptor HER3, which is involved in various cellular processes such as cell proliferation and survival. The HER3 antibody blocks the interaction between HER3 and other growth factors like hepatocyte growth factor and endothelial growth factor, thereby preventing downstream signaling pathways that promote tumor growth.CDC2 antibody
The CDC2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is widely recognized for its exceptional binding properties and specificity towards CDC2, a protein involved in cell division regulation. This antibody has been extensively tested and validated in various research applications.STX17 antibody
The STX17 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to STX17, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in research applications.Diphtheria toxin antibody
Diphtheria toxin antibody was raised in mouse using diphtheria toxin and anatoxin as the immunogen.
CD54 antibody
The CD54 antibody is a monoclonal antibody that targets the CD54 protein, also known as intercellular adhesion molecule-1 (ICAM-1). It is commonly used in life sciences research to study cell growth and signaling pathways. The CD54 antibody binds specifically to the CD54 protein, which plays a crucial role in cell adhesion and immune response. By blocking the interaction between CD54 and its ligands, this antibody can inhibit various cellular processes such as inflammation and tumor progression. Additionally, the CD54 antibody has been used in studies investigating the effects of growth factors, steroids, dopamine, and kinase inhibitors on cell behavior. Its versatility makes it an essential tool for researchers in various fields of study within the life sciences.SRR antibody
The SRR antibody is a highly specific monoclonal antibody that targets the serine protease SRR. This antibody is widely used in various assays and research studies in the field of Life Sciences. It has been proven to effectively inhibit the activity of SRR, leading to lysis of targeted cells. The SRR antibody is commonly used in drug development as an erbb2 inhibitor and has shown promising results in preclinical studies. Additionally, this antibody has been used in research involving interleukin signaling pathways and phosphatase regulation. Its high affinity and specificity make it an ideal tool for studying the role of SRR in various biological processes. The SRR antibody is available for purchase and can be used in both in vitro and in vivo experiments using human serum or human hepatocytes.
EML1 antibody
EML1 antibody was raised using the C terminal of EML1 corresponding to a region with amino acids YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVIClusterin antibody
Clusterin antibody was raised in mouse using recombinant human Clusterin (1-333aa) purified from E. coli as the immunogen.CD1A antibody
The CD1A antibody is a highly specialized monoclonal antibody that targets the elastase protein. It has been extensively biotinylated for easy detection and analysis. This antibody specifically binds to the amino-terminal region of CD1A, a cell surface glycoprotein found on human hepatocytes. The CD1A antibody is widely used in various assays and research applications, including hybridization, ELISA, and immunohistochemistry. It can also be used for the detection and quantification of CD1A in biological samples. With its high specificity and sensitivity, this CD1A antibody is an essential tool for researchers studying the role of CD1A in various physiological processes.
SNRPE antibody
The SNRPE antibody is a highly specialized monoclonal antibody that targets and neutralizes the fatty acid receptor SNRPE. This antibody is widely used in immunoassays and research within the Life Sciences field. It has been shown to have a high affinity for SNRPE, making it an effective tool for studying its role in various biological processes.Epididymal secretory 4 monoclonal antibody
Mouse anti-human epididymal secretory protein 4 monoclonal AntibodyCD279 antibody
The CD279 antibody is a polyclonal antibody that targets the growth factor CD279. It plays a crucial role in regulating actin filaments and has cytotoxic and neutralizing properties. This antibody is commonly used in Life Sciences research to study endothelial growth and other related processes. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. The CD279 antibody specifically binds to CD279, inhibiting its function and allowing for further investigation into its role in various biological processes. Whether you are studying actin or glucagon, this antibody is an essential tool for your research.FGF21 antibody
The FGF21 antibody is a highly specialized product used in the field of Life Sciences. It is an immobilized electrode that specifically targets and binds to the growth factor FGF21. This antibody has been extensively tested and proven to be effective in various applications, including the analysis of human serum biomolecules, collagen activation, chromatographic purification, and binding studies with chemokine and other growth factor binding proteins.SST antibody
The SST antibody is a monoclonal antibody that specifically targets amyloid plaques, which are protein clumps commonly associated with neurodegenerative diseases such as Alzheimer's. This antibody has been extensively used in Life Sciences research to study the formation and progression of these plaques. In addition to its use in research, the SST antibody can also be used in diagnostic applications for detecting the presence of amyloid plaques in patient samples. It has shown high specificity and sensitivity when tested against various forms of amyloid proteins. Furthermore, the SST antibody has demonstrated anti-angiogenesis properties, making it a potential therapeutic option for diseases characterized by abnormal blood vessel growth. With its ability to bind to low-molecular-weight compounds and activated surfaces, this antibody is a versatile tool for studying protein interactions and developing new treatments.
