Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
75602 produits trouvés pour "Anticorps primaires"
NUDT9 antibody
NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGSNGSKENSHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYTGata4 antibody
The Gata4 antibody is a monoclonal antibody that specifically targets the Gata4 protein, which plays a crucial role in various biological processes. This antibody has been extensively tested and shown to be cytotoxic against cells expressing high levels of Gata4, making it a valuable tool for research and diagnostic applications. Additionally, the Gata4 antibody has been used in assays to study the interaction between Gata4 and other proteins, such as urokinase plasminogen activator. It has also been utilized in studies involving adipose tissue and its role in metabolism. This monoclonal antibody is highly specific and exhibits minimal cross-reactivity with other target molecules. With its exceptional binding affinity and selectivity, the Gata4 antibody is an essential tool for researchers studying various cellular processes and developing potential therapeutic inhibitors.
Nav1.7 antibody
The Nav1.7 antibody is a monoclonal antibody that targets the Nav1.7 channel, a key player in pain signaling. This antibody has been extensively studied for its potential therapeutic applications in pain management. It works by blocking the activity of the Nav1.7 channel, which reduces the transmission of pain signals to the brain.
Fibronectin 1 antibody
The Fibronectin 1 antibody is a monoclonal antibody used in Life Sciences for various applications. It is commonly used as a diagnostic reagent to detect the presence of fibronectin 1, a biomolecule involved in cell adhesion and migration. This antibody specifically binds to fibronectin 1 with high affinity and specificity, making it an ideal tool for research and diagnostic purposes.
HAT1 antibody
The HAT1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and inhibit the activity of the HAT1 enzyme, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its efficacy in blocking HAT1 activity in nuclear and adipose tissues.LOC339879 antibody
LOC339879 antibody was raised using the C terminal of LOC339879 corresponding to a region with amino acids HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQLHSP60 antibody
HSP60 antibody was raised in mouse using recombinant human Hsp60 (1-573aa) purified from E. coli as the immunogen.
FBXO25 antibody
FBXO25 antibody was raised using the C terminal of FBXO25 corresponding to a region with amino acids AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKFID2 antibody
The ID2 antibody is a monoclonal antibody that has a high affinity for various proteins, including serum albumin, alpha-fetoprotein, collagen, fibronectin, and erythropoietin. This antibody is widely used in the field of Life Sciences for research purposes. It can be utilized to study protein-protein interactions, as well as to detect the presence of specific proteins in samples. The ID2 antibody has been shown to inhibit the growth of endothelial cells by blocking the activity of certain growth factors. It also plays a role in regulating the glycosylation process and interferon signaling pathways. This antibody is particularly useful in studies related to human serum, androgen metabolism, low-density lipoprotein metabolism, and cancer research. With its versatility and specificity, the ID2 antibody is an invaluable tool for researchers in various fields.GST antibody
GST antibody was raised in mouse using recombinant Glutathione S transferase (GST) purified from E. coli as the immunogen.RSAD2 antibody
RSAD2 antibody was raised using the C terminal of RSAD2 corresponding to a region with amino acids YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYMDM4 antibody
MDM4 antibody was raised in Mouse using a purified recombinant fragment of human MDM4 expressed in E. coli as the immunogen.MIF antibody
The MIF antibody is a highly effective inhibitor that targets the polymers of macrophage migration inhibitory factor (MIF). This monoclonal antibody has neutralizing properties and is specifically designed to block the activity of MIF. It has been extensively used in Life Sciences research, particularly in studies related to annexin A2 and chemokine regulation. The MIF antibody can be used in various experimental techniques, including Western blotting, immunohistochemistry, and flow cytometry. Its high affinity for MIF makes it a valuable tool for researchers studying cardiomyocyte function and investigating the role of MIF in different biological processes. When combined with streptavidin or other detection systems, this monoclonal antibody provides reliable and accurate results. Choose the MIF antibody for your research needs and unlock new insights into the intricate mechanisms of cellular signaling pathways.ALDH1A1 antibody
ALDH1A1 antibody was raised using the middle region of ALDH1A1 corresponding to a region with amino acids SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGRanGAP1 antibody
The RanGAP1 antibody is a highly specialized protein complex that plays a crucial role in various biological processes. It acts as a regulator for the transport of biomolecules between the nucleus and cytoplasm, ensuring proper cellular function. This antibody has been extensively studied for its potential therapeutic applications, particularly in the field of oncology.
VCP antibody
The VCP antibody is an inhibitory factor that targets insulin and other growth factors. This acidic antibody has been shown to inhibit the activity of insulin and epidermal growth factor, preventing their binding to their respective receptors. Additionally, the VCP antibody has cytotoxic effects on cells expressing collagen and fibronectin, making it a potential therapeutic option for diseases involving excessive collagen production. This monoclonal antibody is widely used in Life Sciences research and has also been studied as a potential treatment for autoimmune disorders due to its ability to target autoantibodies. The VCP antibody shows promise in combination with other antibodies such as trastuzumab, an anti-HER2 antibody, in inhibiting tumor growth by blocking growth factor signaling pathways.
PAOX antibody
PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids HSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLARRM1 antibody
The RRM1 antibody is a monoclonal antibody that specifically targets the alpha-msh growth factor receptor. This antibody has high affinity and specificity for the receptor, allowing it to effectively bind and block its activity. It is commonly used in life sciences research to study the function and signaling pathways of the alpha-msh growth factor.MLH1 antibody
MLH1 antibody was raised in Mouse using a purified recombinant fragment of MLH1 (aa381-483) expressed in E. coli as the immunogen.XPOT antibody
XPOT antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLLKLH antibody
KLH antibody is a peptide conjugate that is used to detect and neutralize TGF-β1, a cytokine involved in cell growth and differentiation. This antibody specifically targets and binds to TGF-β1, preventing its interaction with cell receptors and inhibiting its biological activity. In addition to its neutralizing properties, KLH antibody has been shown to have cytotoxic effects on cells expressing TGF-β1 receptors. It can also be used in various life science applications, such as the detection of collagen, interleukin-6, parathyroid hormone-related peptide, hepcidin, and other biomolecules. The high specificity of this monoclonal antibody ensures reliable results in antigen-antibody reactions. Whether you're conducting research or developing diagnostic assays, KLH antibody is an essential tool for your laboratory.SLAMF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound that belongs to the class of antituberculosis drugs known as rifamycins. This powerful drug is specifically designed for the treatment of tuberculosis infection. It exhibits bactericidal activity by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique.GATA3 antibody
GATA3 antibody was raised in Mouse using a purified recombinant fragment of GATA3(aa175-388) expressed in E. coli as the immunogen.HAIR antibody
The HAIR antibody is a highly specialized protein that targets androgen receptors. It is a polyclonal antibody, meaning it is derived from multiple sources and can recognize various epitopes on the target protein. This antibody has cytotoxic properties, meaning it can induce cell death in cells expressing the androgen receptor.RUNX2 antibody
The RUNX2 antibody is a polyclonal antibody widely used in life sciences research. It is reactive and polymorphic, making it suitable for various applications. This antibody specifically targets the RUNX2 protein, which plays a crucial role as a transcription factor involved in bone development and growth. The RUNX2 antibody can be used to study the expression and localization of this protein in different tissues and cell types.RFP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
