Anticorps primaires

Affinity purified Rabbit polyclonal Ataxin 3 antibody

Purified Polyclonal PDE4B/C/D antibody

The EED antibody is a highly specialized and potent anti-mesothelin antibody that is widely used in Life Sciences research. It has the ability to bind specifically to mesothelin, a protein that is involved in cell growth and signaling pathways. This antibody is commonly used in studies related to growth factors, chemokines, and other important biological processes. Additionally, the EED antibody has been shown to have neutralizing properties against mesothelin, making it an ideal tool for studying the effects of this protein in various experimental settings. It can be used in a variety of applications including immunohistochemistry, Western blotting, ELISA, and more. With its high specificity and affinity for mesothelin, the EED antibody provides researchers with a valuable tool for understanding the role of this protein in disease development and progression.

Rabbit polyclonal Clofibrate antibody

EIF6 antibody was raised in rabbit using the C terminal of EIF6 as the immunogen

The CDC45L antibody is a highly specialized monoclonal antibody that targets the CDC45L protein. This protein plays an important role in various biological processes, including DNA replication and cell cycle regulation. By specifically binding to CDC45L, this antibody can effectively inhibit its function and disrupt these processes.

The CtBP2 antibody is a highly specialized antibody that targets the anti-ICOS antibodies. It specifically binds to serum albumin protein and agonist proteins, effectively neutralizing their activity. This antibody has been extensively tested in various laboratory settings, including liver microsomes and drug antibody assays. It has shown potent chemokine-neutralizing properties, making it an essential tool for researchers in the life sciences field. The CtBP2 antibody is available in both polyclonal and monoclonal forms, providing flexibility for different experimental setups. Its activation potential and ability to target autoantibodies and growth factors make it a valuable asset in research studies.

human NPY1R C-terminal peptide immunoge, Affinity purified Rabbit polyclonal NPY1R antibody, lyophilized

CD25 antibody (Azide free) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell as the immunogen.

BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW

The Ki67 antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody produced by a hybridoma cell line, specifically designed for the immunohistochemical detection of activated cells. The Ki67 antibody targets the Ki67 protein, which is a marker of cellular proliferation and is commonly used as a growth factor indicator.

The Syntaxin 5 antibody is a highly specialized neurotrophic factor that plays a crucial role in various biological processes. This antibody is designed to specifically target and bind to the Syntaxin 5 protein, which is involved in the regulation of chemokine activity and the activation of interferon and insulin signaling pathways.

The NOB1 antibody is a cytotoxic antibody-drug that specifically targets the tyrosine residues in the nuclear region of cells. This antibody has been shown to inhibit the production of interleukin-6 (IL-6), a pro-inflammatory cytokine, by binding to its cell surface antigen. Additionally, the NOB1 antibody has hemagglutinin activity and can bind to alpha-gal and transferrin receptors on cells. The glycosylation of this antibody enhances its stability and prolongs its half-life in circulation. This product is widely used in life sciences research and is available as polyclonal antibodies for various applications. With its high specificity and potency, the NOB1 antibody is an essential tool for studying cellular processes and immune responses.

Affinity purified Chicken polyclonal NET1 antibody

The VTA1 antibody is a monoclonal antibody that has been developed for use in chemotherapy. It specifically targets tumor-related macrophages and works by inhibiting the production of interleukin, a protein that promotes tumor growth. The VTA1 antibody can also bind to autoantibodies and antibodies present in the body, thereby reducing their activity and preventing them from attacking healthy cells. Additionally, this antibody recognizes specific glycans on the surface of cancer cells, making it an effective tool in Life Sciences research. It has also shown antiviral properties and can be used in the development of new treatments for viral infections. The VTA1 antibody is available as both a monoclonal and polyclonal form, allowing researchers to choose the option that best suits their needs. With its ability to target antigens extracellularly and withstand high-flux irradiation, this antibody is a valuable asset in the field of cancer research and treatment.

Rabbit polyclonal SIK antibody

The Lp-PLA2 monoclonal antibody is a powerful growth factor that targets specific proteins involved in the regulation of collagen and fatty acid metabolism. This antibody is designed to bind to Lp-PLA2, an enzyme responsible for the production of inflammatory mediators. By inhibiting this enzyme, the monoclonal antibody reduces inflammation and promotes healthy tissue repair.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. Extensive research has shown its high activity on human erythrocytes using the patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

The HCG beta Antibody is a specific monoclonal antibody that is commonly used in Life Sciences research. It has been extensively studied and proven to be highly effective in various applications. This antibody specifically targets the influenza hemagglutinin, which plays a crucial role in receptor binding and viral entry.

Affinity purified Rabbit polyclonal MAPK1 antibody