CymitQuimica logo
Anticorps primaires

Anticorps primaires

Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.

Sous-catégories appartenant à la catégorie "Anticorps primaires"

Affichez 1 plus de sous-catégories

75323 produits trouvés pour "Anticorps primaires"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • hCG antibody


    <p>hCG antibody was raised in goat using hCG affinity purified as the immunogen.</p>

    Ref: 3D-70-XG30

    Produit arrêté
  • Cystatin C antibody


    <p>Rabbit polyclonal Cystatin C antibody</p>

    Ref: 3D-20-B9123R

    Produit arrêté
  • Myoglobin antibody


    <p>Polyclonal Myoglobin antibody</p>
  • Mouse Anti-Human IgG Fc Biotin Conjugate


    Couleur et forme :Colorless to Almost colorless clear liquid

    Ref: 3B-M3053

    Produit arrêté
  • Fluorescein Isothiocyanate (mixture of 5- and 6- isomers)

    CAS :
    Formule :C21H11NO5S
    Degré de pureté :>97.0%(T)(HPLC)
    Couleur et forme :Light yellow to Brown powder to crystal
    Masse moléculaire :389.38
  • o-Dianisidine Dihydrochloride [for Biochemical Research]

    CAS :
    Formule :C14H16N2O2·2HCl
    Degré de pureté :>98.0%(HPLC)
    Couleur et forme :White to Gray to Red powder to crystal
    Masse moléculaire :317.21

    Ref: 3B-D3893

    Produit arrêté
  • Candida Albicans Antigen


    <p>A wild strain sourced Candida Albicans Antigen, consisting of cytoplasmic and cell wall components presented in an alkaline pH glycine buffer. The antigen is presented as washed harvested organisms that have been disrupted and subjected to an extraction process. The infectivity has been confirmed negative by the absence of growth under original cell culture conditions. It is important to note this product needs to be sonicated before used and repeated freezing and thawing needs to be avoided.The Candida Albicans Antigen is a part of the human fungal pathogen Candida Albicans in humans, mainly colonizing in areas of the gastrointestinal tract, vagina and cutaneous areas. The cell wall components of this antigen are home to the immunodominant antigens in candidiasis and are responsible for generating a response from the host's immune system. Proteins and the glycoproteins mannoproteins, located within this cell wall, interact with the exocellular environment. Research applications of this antigen can be in the development of immunoassays such as ELISA.</p>
    Degré de pureté :Min. 95%
  • HBsAg Mouse Monoclonal Antibody


    <p>Purified by Protein A chromatography in PBS, pH 7.4, this mouse monoclonal antibody product is complementary to native hepatitis B surface antigen (HBsAg) and is available as two clones: 1005011 and 1005021. Potential applications of this Mab are in ELISA and lateral flow assays and in the diagnosis of the Hepatitis B (HB) infection which is a necroinflammatory liver disease with the potential to cause liver cirrhosis and heptacellular carcinoma. Clone 1005021 is recommended as a capture antibody and clone 1005011 is recommended as detection antibody.<br>The term HBsAg collectively refers to the three particle forms: Dane, filamentous and spherical of the HB virus which are made up of small HBs proteins (SHBs), middle HBs proteins (MHBs) and large HBs proteins (LHBs). These HBsAg proteins envelop the viral nucleocapsid and binds to the viral core. The LHB has a pre-S1, pre-S2 and S domain, the MHB does not have this pre-S1 domain while SHBs only have the S domain. The S domains ability to form disulphide cross-linked dimers allows Dane particles of the HBsAg to interact with sulphated proteoglycans on host cells, resulting in the activation of HB infection. Furthermore residues 2-48 which make up a conserved N-terminal sequence on the pre-S1 domain allows HBsAg to bind to the Na+-Taurocholate Co-transporter Polypeptide (NTCP) on hepatocytes.</p>
  • Zika Virus Envelope Antigen Mouse Monoclonal Antibody


    <p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>
  • Ferritin antibody (M89619)


    <p>Anti-Ferritin monoclonal antibody; &gt;95% pure (SDS-PAGE)</p>

    Ref: 3D-10-4184

    Produit arrêté
  • STAT2 antibody


    <p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

    Ref: 3D-70R-20572

    Produit arrêté
  • RARB antibody


    <p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>
  • RRAS antibody


    <p>Rabbit polyclonal RRAS antibody</p>
  • Tetanus toxin antibody


    <p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>
    Degré de pureté :>92% By Gel Electrophoresis And Gel Scanning
  • RSU1 antibody


    <p>Rabbit polyclonal RSU1 antibody</p>
  • HSV2 gC antibody


    <p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>
  • Legionella pneumophila LPS antibody


    <p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

    Ref: 3D-10-7870

    Produit arrêté
  • PSCA antibody


    <p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>
  • Mouse Isotyping Kit


    <p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>
    Degré de pureté :Min. 95%
  • SURVIVIN antibody


    <p>The SURVIVIN antibody is a powerful tool in the field of Life Sciences. It is an essential biomolecule that plays a crucial role in cell survival and proliferation. This antibody specifically targets survivin, an anti-apoptotic protein that is highly expressed in various tumor cells.</p>

    Ref: 3D-70R-21713

    Produit arrêté