Anticorps primaires

Affinity purified Rabbit polyclonal PPP2R5B antibody

FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE

ADSS antibody was raised in Rabbit using Human ADSS as the immunogen

Rabbit polyclonal TPH1 antibody (Ser260)

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Rabbit polyclonal GPR19 antibody

Rabbit polyclonal IL8R beta antibody (Ser347)

Purified Polyclonal MCT8 antibody

Granzyme A antibody is a monoclonal antibody that specifically targets and binds to granzyme A, a serine protease enzyme involved in immune response and cell death. This antibody can be used for various applications in the field of Life Sciences, including research on immune system function, cancer therapy, and autoimmune diseases. It has been shown to inhibit the activity of granzyme A by blocking its binding to target cells. Additionally, this antibody has been used in experiments to study the effects of granzyme A on dopamine release, hormone peptide processing, and liver microsome metabolism. With its high specificity and affinity for granzyme A, this monoclonal antibody is a valuable tool for researchers studying immune regulation and cell signaling pathways.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.