Acides aminés (AA)
Les acides aminés (AA) sont les éléments constitutifs fondamentaux des protéines, jouant un rôle crucial dans divers processus biologiques. Ces composés organiques sont essentiels pour la synthèse des protéines, les voies métaboliques et la signalisation cellulaire. Dans cette catégorie, vous trouverez une gamme complète d'acides aminés, y compris des formes essentielles, non essentielles et modifiées, qui sont vitales pour la recherche en biochimie, biologie moléculaire et sciences de la nutrition. Chez CymitQuimica, nous fournissons des acides aminés de haute qualité pour soutenir vos besoins en recherche et développement, garantissant précision et fiabilité dans vos résultats expérimentaux.
Sous-catégories appartenant à la catégorie "Acides aminés (AA)"
- Dérivés d'acides aminés(4.015 produits)
- Acide aminé et composés apparentés aux acides aminés(3.490 produits)
- Acides aminés avec de l'oxygène ou du soufre(168 produits)
- Boc- Acides aminés(351 produits)
- Acides aminés avec groupes protecteurs(1.710 produits)
38368 produits trouvés pour "Acides aminés (AA)"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt
CAS :Produit contrôléPlease enquire for more information about H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C47H84N18O8Degré de pureté :Min. 95%Masse moléculaire :1,029.29 g/molCholecystokinin Octapeptide (1-6) (desulfated)
CAS :Please enquire for more information about Cholecystokinin Octapeptide (1-6) (desulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C36H47N7O10S2Degré de pureté :Min. 95%Masse moléculaire :801.93 g/molBz-Phe-Val-Arg-AMC hydrochloride salt
CAS :Bz-Phe-Val-Arg-AMC is a synthetic substrate that is used to measure proteolytic activity. It has been shown to be hydrolyzed by serine proteases, such as trypsin and chymotrypsin, at a rate proportional to the enzyme's concentration. The rate of hydrolysis was determined using a kinetic assay in which the release of AMC from the peptide bond was measured using an ultraviolet spectrophotometer. Bz-Phe-Val-Arg-AMC has also been used to study the effects of various food additives on proteolytic activity. This test can be used as a diagnostic tool for inflammatory diseases, such as Crohn's disease and ulcerative colitis.Formule :C37H43N7O6Degré de pureté :Min. 95%Masse moléculaire :681.78 g/molH-Gly-Pro-Gly-OH
CAS :H-Gly-Pro-Gly-OH is a glycan molecule. It is an artificially synthesized glycan that was designed to act as a neutralizing agent for HIV. It binds to the envelope protein gp120 and prevents it from binding to CD4 receptors on cells, thereby preventing viral entry into the cell. H-Gly-Pro-Gly-OH has also been shown to be effective in neutralizing collagenase activity, which may be useful in treating arthritis and other autoimmune disorders. H-Gly-Pro-Gly-OH has been shown to bind to monoclonal antibodies that are used in the development of cancer treatments, such as Herceptin and Erbitux. This binding is thought to be due to sequences within the antibody that correspond with those found on gp120, the envelope protein of HIV.Formule :C9H15N3O4Degré de pureté :Min. 95%Masse moléculaire :229.23 g/molO-Hippuryl-DL-b-phenyllactic acid sodium salt
CAS :Please enquire for more information about O-Hippuryl-DL-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C18H16NNaO5Degré de pureté :Min. 95%Masse moléculaire :349.31 g/molH-Asp-AMC
CAS :Please enquire for more information about H-Asp-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H14N2O5Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :290.27 g/molFMoc-L-4-BroMophenylalanine
CAS :FMoc-L-4-BroMophenylalanine is a cell culture substrate that is used to study the interaction between peptides and hydrogels. It can be used as a fluorescent probe in peptide binding assays as well as for studies of protein folding. This product has been shown to be efficient at inducing gelation with other amino acids, such as aspartic acid, glycine, and arginine. FMoc-L-4-BroMophenylalanine also has potential applications for use in classifying peptides based on their charge and size.Formule :C24H20BrNO4Degré de pureté :Min. 95%Masse moléculaire :466.32 g/molDibenzoyl-(-)-p-methoxy-L-tartaric acid
CAS :Dibenzoyl-(-)-p-methoxy-L-tartaric acid is a chiral compound that has been extracted from plants and synthesized. It has a bitter taste and can be used as an enantiomer to treat schistosomiasis, a disease caused by parasitic flatworms. Dibenzoyl-(-)-p-methoxy-L-tartaric acid can be used as an enantiomer to treat schistosomiasis, which is caused by parasitic flatworms. The chemical is an anionic β-cyclodextrin derivative that binds to the parasites in the host's body and prevents them from releasing eggs into the water supply. This chemical also has pharmacological properties, such as antiinflammatory activities.
Formule :C20H18O10Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :418.35 g/mol3-Methylsalicylic acid
CAS :3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.Formule :C8H8O3Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :152.15 g/molH-Ala-Phe-Pro-OH
CAS :Please enquire for more information about H-Ala-Phe-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C17H23N3O4Degré de pureté :Min. 95%Masse moléculaire :333.38 g/molBoc-Ala-D-Glu-NH2
CAS :Please enquire for more information about Boc-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C13H23N3O6Degré de pureté :Min. 95%Masse moléculaire :317.34 g/molH-Gly-Phe-Ser-OH
CAS :H-Gly-Phe-Ser-OH is a substrate for thermolysin, an enzyme that catalyzes the hydrolysis of peptides to amino acids. It is modified by glycerol, which influences its affinity and nature. The residue can be either modified or unmodified with a specific chain length. The modifications of the residue are important in determining the specificity of the enzyme. H-Gly-Phe-Ser-OH has a high degree of hydrophobicity, which influences the catalytic reaction. This substrate can be used to determine enzyme specificity because it is not cleaved by enzymes such as trypsin and chymotrypsin.Formule :C14H19N3O5Degré de pureté :Min. 95%Masse moléculaire :309.32 g/molH-Ala-Tyr-Ala-OH
CAS :H-Ala-Tyr-Ala-OH is a peptidomimetic that has shown promising anti-inflammatory and anticancer properties. It has been found to inhibit the proliferation of human cancer cells and to suppress the growth of human tumor xenografts in mice. It also has shown an ability to cross the blood brain barrier, which may be due to its high lipophilicity. H-Ala-Tyr-Ala-OH inhibits the production of inflammatory cytokines, such as TNFα, IL1β, IL6, and IL8, by inhibiting NFκB activation in immune cells. This inhibition leads to decreased inflammation and fibrosis in various tissues. H-Ala-Tyr-Ala-OH is also active against bacteria and viruses, which may be due to its low molecular weight.Formule :C15H21N3O5Degré de pureté :Min. 95%Masse moléculaire :323.34 g/molFmoc-Val-Wang resin (200-400 mesh)
Please enquire for more information about Fmoc-Val-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Angiotensin II Receptor Ligand Nicotinoyl-Tyr-Lys(Z-Arg)-His-Pro-Ile-OH
CAS :Angiotensin II receptor ligand nicotinoyl-tyrosine-arginine-proline-ile (ANGII) is a peptide that acts as a potent angiotensin II receptor agonist. It can be used to anesthetize rats and cause bradykinin b2 receptor activation. ANGII has been shown to inhibit the growth of several types of tumors, such as human melanoma cells, in animal experiments. This drug also has antiangiogenic properties, which may be due to its ability to induce the production of tumor necrosis factor-α (TNF-α).Formule :C52H69N13O11Degré de pureté :Min. 95%Masse moléculaire :1,052.19 g/molFA-Phe-Val-NH2
CAS :Please enquire for more information about FA-Phe-Val-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C21H25N3O4Degré de pureté :Min. 95%Masse moléculaire :383.44 g/mol4-Bromophenylalanine
CAS :4-Bromophenylalanine is a chemical compound that can be used as a spectroscopic probe to study the dynamics of protein synthesis. It is derived from 4-bromobenzaldehyde, which is oxidized by hydrogen peroxide in the presence of cytochrome P450 reductase and NADPH, yielding 4-bromophenylalanine. This compound has been shown to inhibit protein synthesis by binding reversibly to the synthetase during its synthetic cycle. The binding of 4-bromophenylalanine inhibits the synthesis of peptides with a C-terminal amide group. This inhibition leads to a decrease in the amount of functional groups present in proteins and an increase in the amount of buffers. These effects have been demonstrated through modelling studies using both model organisms and buffer solutions.Formule :C9H10BrNO2Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :244.09 g/molC-Peptide 2 (rat) trifluoroacetate salt
CAS :Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C135H222N38O49Degré de pureté :Min. 95%Masse moléculaire :3,161.43 g/molZ-Trp-Val-OH trifluoroacetic acid
CAS :Please enquire for more information about Z-Trp-Val-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C24H27N3O5•CF3CO2HDegré de pureté :Min. 95%Masse moléculaire :437.49 g/molBoc-Pen (NPys)-OH
CAS :Please enquire for more information about Boc-Pen (NPys)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C15H21N3O6S2Degré de pureté :Min. 95%Masse moléculaire :403.48 g/mol(D-Leu7)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about (D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C55H75N17O13Degré de pureté :Min. 95%Masse moléculaire :1,182.29 g/molL-Tyrosine methyl ester hydrochloride
CAS :L-Tyrosine methyl ester hydrochloride is a synthetic compound that has been shown to have anti-thrombotic and anti-inflammatory properties. In particular, L-Tyrosine methyl ester hydrochloride inhibits the activity of thrombin, which is an enzyme involved in the coagulation process. It has also been shown to be effective against solid tumours and cell cultures. L-Tyrosine methyl ester hydrochloride is used as a pharmaceutical preparation for the treatment of osteoarthritis, rheumatoid arthritis, and other inflammatory disorders. It is also used as a precursor in the synthesis of amino acid compounds such as L-DOPA.Formule :C10H14ClNO3Degré de pureté :Min. 95%Masse moléculaire :231.68 g/molAc-Phe-Phe-OH
CAS :Please enquire for more information about Ac-Phe-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C20H22N2O4Degré de pureté :Min. 95%Masse moléculaire :354.4 g/molH-Gly-Gly-Sar-OH
CAS :Gly-Gly-Sar is a synthetic peptide that acts as a substrate for the peptide transporter, which is part of the membrane of cells. It is an amide with a reactive group that can form a ternary complex with two hydroxyl ions and one proton. Gly-Gly-Sar has been shown to be taken up by caco-2 cells in an extravesicular manner and undergoes proteolysis by peptidases. This leads to bond cleavage and formation of free Gly-Gly and Sar. The free Gly and Gly are then transported across the cell membrane into the cell cytoplasm, where they are hydroxylated by enzymes such as glycyl-l-leucine hydroxylase to form glycolic acid and glyoxylic acid, respectively.
Formule :C7H13N3O4Degré de pureté :Min. 95%Masse moléculaire :203.2 g/molCortistatin-17 (human) trifluoroacetate salt
CAS :Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C96H139N27O24S3Degré de pureté :Min. 95%Masse moléculaire :2,151.5 g/molBoc 8-Lys4-Lys2-Lys-b-Ala-PAM resin (200-400 mesh)
CAS :Boc 8-Lys4-Lys2-Lys-b-Ala-PAM resin (200-400 mesh) is a versatile research chemical used in various applications. It contains aminooxyacetic acid, which is commonly used in the synthesis of fatty acids and other organic compounds. This resin is often employed in the purification and separation of target molecules, such as ochratoxin, collagen, synthetic cannabinoids, naphthalene derivatives, fatty acids, steroids, and more. Additionally, it can be utilized as an inhibitor for various enzymes or complexes like arp2/3 complex. The Boc 8-Lys4-Lys2-Lys-b-Ala-PAM resin has also been used in the synthesis of cefazolin sodium, an antibiotic widely used in medical settings. With its high-quality composition and fine particle size (200-400 mesh), this resin offers excellent performance and efficiency for biomass-related studies and other research endeavors.Formule :C45H91N15O9·xC2HF3O2Degré de pureté :Min. 95%PAR-3 (1-6) amide (human) trifluoroacetate salt
Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C29H46N10O7Degré de pureté :Min. 95%Masse moléculaire :646.74 g/molNeurokinin A trifluoroacetate salt
CAS :Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.Formule :C50H80N14O14SDegré de pureté :Min. 95%Masse moléculaire :1,133.32 g/molAtrial Natriuretic Factor (1-29) (chicken)
CAS :Please enquire for more information about Atrial Natriuretic Factor (1-29) (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C124H211N47O40S5Degré de pureté :Min. 95%Masse moléculaire :3,160.62 g/molMonocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt
CAS :Please enquire for more information about Monocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H98N18O22Degré de pureté :Min. 95%Masse moléculaire :1,411.52 g/molH-Lys-Ala-Pro-OH hydrochloride salt
Please enquire for more information about H-Lys-Ala-Pro-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H26N4O4Degré de pureté :Min. 95%Masse moléculaire :314.38 g/molZ-Ala-Pro-OH
CAS :Z-Ala-Pro-OH is a synthetic, analog substrate for serine proteases. It is used as a target cell for schistosomiasis, which are parasitic worms that infect humans and cause the disease. The molecule is localized in the digestive tract of the parasite, where it has biochemical properties that are analogous to those found in the natural substrate (serine protease) of this organism. Z-Ala-Pro-OH has been shown to inhibit the growth of various species of schistosomes, including Schistosoma mansoni. It also has immunoregulatory properties and can be used to stimulate antibody production by B cells when combined with an antigen.Formule :C16H20N2O5Degré de pureté :Min. 95%Masse moléculaire :320.34 g/molLauroyl lysine
CAS :Lauroyl lysine (N6-Lauroyl-L-lysine) functions as skin and hair conditioning agents and as surfactants-cleansing agents in personal care products.Formule :C18H36N2O3Degré de pureté :99.18%Couleur et forme :White To Off-White Solid With Characteristic Faint OdorMasse moléculaire :328.49Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt
CAS :Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C51H93N15O14S2Degré de pureté :Min. 95%Masse moléculaire :1,204.51 g/molH-Cys(Acm)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
Please enquire for more information about H-Cys(Acm)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Fmoc-3-(2-naphthyl)-L-alanine
CAS :Fmoc-3-(2-naphthyl)-L-alanine is a supramolecular compound that functions as an inhibitor of prostate cancer cells. It inhibits the uptake of metal chelates by prostate cancer cells and stabilizes them, which may lead to a diagnostic and therapeutic agent for prostate cancer. Fmoc-3-(2-naphthyl)-L-alanine has also been shown to inhibit the growth of human serum prostate cancer cells in vitro and in vivo models. This molecule is a bifunctional compound that can be used as both an antigen and a surrogate for cytosolic prostate specific antigen (PSA) levels. Fmoc-3-(2-naphthyl)-L-alanine has been shown to bind to the PSA protein, which is normally found on the surface of prostate epithelial cells. This binding prevents it from being released into the blood circulation, where it would otherwise be measured by a PSA testFormule :C28H23NO4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :437.49 g/mol2'-Methoxy-alpha-naphthoflavone
CAS :2'-Methoxy-alpha-naphthoflavone is a fine chemical that can be synthesized from naphthalene, benzaldehyde, and methoxyacetic acid. It is a versatile building block for research chemicals and has been shown to have high quality. 2'-Methoxy-alpha-naphthoflavone has been used as a reaction component in the synthesis of complex compounds with interesting biological activities.Formule :C20H14O3Degré de pureté :Min. 95%Masse moléculaire :302.32 g/molNeurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt
CAS :Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C35H52N8O12Degré de pureté :Min. 95%Masse moléculaire :776.83 g/molBoc-Thr(Gly-Fmoc)-OH
CAS :Please enquire for more information about Boc-Thr(Gly-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C26H30N2O8Degré de pureté :Min. 95%Masse moléculaire :498.53 g/molFmoc-Arg(Pbf)-Wang resin (200-400 mesh)
Please enquire for more information about Fmoc-Arg(Pbf)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%(Sar 9,Met(O2)11)-Substance P
CAS :Substance P is a neuropeptide that is found in the brain and throughout the peripheral nervous system. It has been found to be involved in numerous physiological processes, including pain transmission, vasodilation, and inflammation. Substance P binds to neurokinin-1 receptor (NK-1R) with high affinity. NK-1R has been shown to be localized on cells of the submandibular gland and salivary gland. Techniques such as binding experiments have shown that substance P binds to NK-1R with high affinity and is therefore likely involved in salivation and other functions of these glands.Formule :C64H100N18O15SDegré de pureté :Min. 95%Masse moléculaire :1,393.66 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS :Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C66H88N14O14Degré de pureté :Min. 95%Masse moléculaire :1,301.49 g/molBoc-Phe-Leu-Phe-Leu-Phe-OH
CAS :Boc-Phe-Leu-Phe-Leu-Phe-OH is a cyclase inhibitor that binds to the receptor molecule, which is part of the signaling pathway of chemotactic activity. It has been shown in vitro to inhibit the proliferation of diabetic retinopathy cells and to have chemotactic activity for polymorphonuclear leucocytes. Boc-Phe-Leu-Phe-Leu-Phe-OH is also an antagonist of chelerythrine, which is a potent activator of hl60 cells and a potent inhibitor of microbial infections.Formule :C44H59N5O8Degré de pureté :Min. 95%Masse moléculaire :785.97 g/molH-D-Arg(Pbf)-allyl ester hydrochloride
CAS :Please enquire for more information about H-D-Arg(Pbf)-allyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C22H34N4O5S•HClDegré de pureté :Min. 95%Masse moléculaire :503.06 g/molH-Thr-Tyr-Ser-OH
CAS :H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.Formule :C16H23N3O7Degré de pureté :Min. 95%Masse moléculaire :369.37 g/molH-Gly-Cys-Gly-OH
CAS :H-Gly-Cys-Gly-OH is an amino acid sequence that has been evaluated for its interactions with other amino acids and proteins. It is a tripeptide heterocycle and can be found in the tissues of many organisms, including humans. H-Gly-Cys-Gly-OH can be found in bovine serum and has been shown to have reversed phase high performance liquid chromatography activity. This molecule also interacts with reversed phase high performance liquid chromatography, ion exchange, and tripeptides.Formule :C7H13N3O4SDegré de pureté :Min. 95%Masse moléculaire :235.26 g/mol(Des-Tyr1)-Met-Enkephalin
CAS :Des-Tyr1-Met-Enkephalin H-Gly-Gly-Phe-Met-OH is a peptide that is derived from the endorphin family. It has been shown to have both amnestic and enkephalin effects, which may be due to its antagonistic effect on naloxone. This endogenous peptide has been studied in a dose response curve, with an increase in amnesia and decrease in memory retention as the dose increases. Des-Tyr1-Met-Enkephalin H-Gly-Gly-Phe-Met-OH also binds to receptors at the same sites as other substances such as epinephrine, β endorphin, and behavioral effects are observed.
Formule :C18H26N4O5SDegré de pureté :Min. 95%Masse moléculaire :410.49 g/molGRF (human) acetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H358N72O66SDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :5,039.65 g/mol(Des-Ala3)-GHRP-2
CAS :Please enquire for more information about (Des-Ala3)-GHRP-2 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C42H50N8O5Degré de pureté :Min. 95%Masse moléculaire :746.9 g/molRetrocyclin-1 trifluoroacetate salt
CAS :Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.Formule :C74H128N30O18S6Degré de pureté :Min. 95%Masse moléculaire :1,918.4 g/molBand 3 Protein (824-829) (human)
CAS :Please enquire for more information about Band 3 Protein (824-829) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C37H65N11O8Degré de pureté :Min. 95%Masse moléculaire :791.98 g/mol(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS :Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H77N17O11Degré de pureté :Min. 95%Masse moléculaire :1,200.35 g/molSuc-Val-Pro-Phe-SBzl
CAS :Suc-Val-Pro-Phe-SBzl is a synthetic subtilisin that has been modified to have an enhanced binding affinity for the enzyme's substrate. The enzyme's specificity and reactivity has been improved by adding a chloromethyl ketone group to the amino acid sequence. Suc-Val-Pro-Phe-SBzl is a serine protease inhibitor and has been shown to inhibit the activity of subtilisins, including subtilisin BPN' and Bacillus amyloliquefaciens subtilisin. It also inhibits peptidases and proteinases, which may be due to its ability to bind to the active site of these enzymes.Formule :C30H37N3O6SDegré de pureté :Min. 95%Masse moléculaire :567.7 g/molMca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt
CAS :Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C68H88N14O27Degré de pureté :Min. 95%Masse moléculaire :1,533.5 g/molCytochrome C (88-104) (domestic pigeon) trifluoroacetate salt
CAS :Please enquire for more information about Cytochrome C (88-104) (domestic pigeon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C84H144N24O25Degré de pureté :Min. 95%Masse moléculaire :1,890.19 g/molMethylenedi-p-phenyl diisocyanate
CAS :Methylenedi-p-phenyl diisocyanate (MDI) is a glycol ether, which is a potent inducer of allergic reactions. It can be found in polyurethane foam insulation and in the production of diphenyl and diisocyanate. MDI has been shown to cause asthma, skin inflammation, and other respiratory problems. MDI is highly toxic to aquatic life and can cause long term effects on fish populations. The toxicity of MDI depends on the concentration and duration of exposure, as well as the species that it is administered to. High concentration exposure for a short period of time will result in death by respiratory failure or cardiac arrest. Longer exposure at lower concentrations may lead to liver, kidney, lung damage or cancerous tumor development.Formule :C15H10N2O2Degré de pureté :Min. 95%Masse moléculaire :250.25 g/mol(S)-(+)-Glycidyl-4-nitrobenzoate
CAS :Glycidyl-4-nitrobenzoate (GLYNB) is an opioid receptor ligand, which binds to the κ opioid receptor. It has been used in biological testing and has been shown to have affinity for the κ opioid receptor. GLYNB may be a useful tool for investigating the molecular diversity of this receptor and its function in both normal and pathological conditions.Formule :C9H9NO6SDegré de pureté :Min. 95%Masse moléculaire :259.24 g/molMethyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate
CAS :Methyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate is a natural compound, which belongs to the group of ferulate esters. It has been shown that methyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate inhibits the activity of esterases, which are enzymes that hydrolyze esters. This inhibition leads to an accumulation of ferulic acid in the blood, which is associated with bowel disease. Methyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate has been shown to be effective against murine hepatoma cells and polymorphonuclear leucocytes, which are white blood cells that can be found in the blood and other tissues. The inhibitory effect on these cells may be due to its ability to bind to ferulic acid and caffeic acids.Formule :C11H12O4Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :208.21 g/molGalanin (1-13)-Mastoparan
CAS :Galanin is a peptide that is part of the galaninergic system. It is involved in the regulation of insulin resistance, pain sensation, and chronic bronchitis. Galanin has been found to inhibit ATP-sensitive K+ channels and to have an inhibitory effect on ryanodine receptors. This inhibition leads to an increase in cytosolic Ca2+. Galanin also inhibits the release of inflammatory cytokines such as IL-1β, IL-6, and TNF-α. The biological properties of galanin are not fully understood and it may be associated with cancer and autoimmune diseases.Formule :C133H222N34O32Degré de pureté :Min. 95%Masse moléculaire :2,809.4 g/molAcetyl-Hirudin (55-65) (desulfated) Ac-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-Gln-OH
CAS :Please enquire for more information about Acetyl-Hirudin (55-65) (desulfated) Ac-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C66H92N12O25Degré de pureté :Min. 95%Masse moléculaire :1,453.5 g/molLHRH II trifluoroacetate salt
CAS :LHRH II trifluoroacetate salt is a peptide hormone that is used to treat prostate cancer, breast cancer, and endometriosis. It binds to the ryanodine receptor in the cell membrane and induces the release of calcium from intracellular stores. LHRH II trifluoroacetate salt also promotes polymerase chain reactions which are important for DNA replication. This drug has been shown to increase epidermal growth factor (EGF) levels in carcinoma cell lines and has transcriptional regulatory activity in a model system. LHRH II trifluoroacetate salt can be used as an experimental model for clinical relevance because it can be used to study how hormones affect cellular processes such as transcriptional regulation.Formule :C60H69N17O13Degré de pureté :Min. 95%Masse moléculaire :1,236.3 g/molH-β-Ala-Val-OH
CAS :H-beta-Ala-Val-OH is a synthetic amino acid that has been positioned in the beta helix of a crystallographic protein. It has a helical structure with an alpha carbon backbone. The dipeptide is water soluble and dipeptides are found in helices, which are hydrogen bonded to other helices. H-beta-Ala-Val-OH also has supramolecular properties, which means it can form structures on its own that are not dependent on other molecules.Formule :C8H16N2O3Degré de pureté :Min. 95%Masse moléculaire :188.22 g/molSplenopentin acetate salt
CAS :Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).Formule :C31H51N9O9Degré de pureté :Min. 95%Masse moléculaire :693.79 g/molH-Lys-Phe-OH·HCl
CAS :Please enquire for more information about H-Lys-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C15H23N3O3·HClDegré de pureté :Min. 95%Masse moléculaire :329.82 g/mol(D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS :Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C136H210N40O31SDegré de pureté :Min. 95%Masse moléculaire :2,933.44 g/mol(Tyr38,Phe42·46)-Osteocalcin (38-49) (human)
CAS :Please enquire for more information about (Tyr38,Phe42·46)-Osteocalcin (38-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C73H101N19O17Degré de pureté :Min. 95%Masse moléculaire :1,516.7 g/molH-Tyr-Thr-NH2 hydrochloride salt
CAS :Please enquire for more information about H-Tyr-Thr-NH2 hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C13H19N3O4Degré de pureté :Min. 95%Masse moléculaire :281.31 g/molCys-Gly-His-Gly-Asn-Lys-Ser-Amyloid b-Protein (33-40) trifluoroacetate salt
CAS :Please enquire for more information about Cys-Gly-His-Gly-Asn-Lys-Ser-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C58H99N19O18S2Degré de pureté :Min. 95%Masse moléculaire :1,414.66 g/molAc-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt
CAS :Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C104H146N24O23SDegré de pureté :Min. 95%Masse moléculaire :2,132.49 g/molAdrenomedullin (16-31) (human, pig)
CAS :Please enquire for more information about Adrenomedullin (16-31) (human, pig) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C82H129N25O21S2Degré de pureté :Min. 95%Masse moléculaire :1,865.19 g/molH-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH
CAS :Please enquire for more information about H-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C18H32N6O7Degré de pureté :Min. 95%Masse moléculaire :444.48 g/molGalanin (1-16) (mouse, porcine, rat)
CAS :Please enquire for more information about Galanin (1-16) (mouse, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C78H116N20O21Degré de pureté :Min. 95%Masse moléculaire :1,669.88 g/mol1-Methyl-4-nitro-1H-pyrazole-3-carboxamide
CAS :Please enquire for more information about 1-Methyl-4-nitro-1H-pyrazole-3-carboxamide including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt
CAS :(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as
Formule :C109H163N25O32SDegré de pureté :Min. 95%Masse moléculaire :2,367.68 g/mol(Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS :Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C43H69N9O11SDegré de pureté :Min. 95%Masse moléculaire :920.13 g/mol(Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt
CAS :Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C64H107N25O19S2Degré de pureté :Min. 95%Masse moléculaire :1,594.82 g/molFmoc-Tyr(PO3(MDPSE)2)-OH
CAS :Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C54H54NO8PSi2Degré de pureté :Min. 95%Masse moléculaire :932.15 g/mol(2-(2-Methoxyethoxy)ethoxy)acetic acid
CAS :2-(2-Methoxyethoxy)ethoxy)acetic acid (MEAA) is a cell stabilizer that can be used in the treatment of cancer, diabetes, and other diseases. MEAA has been shown to inhibit the growth of cells by binding to and stabilizing the cytoskeleton through inhibition of protein synthesis. It also prevents the activation of pro-inflammatory cytokines and reactive oxygen species. MEAA's magnetic resonance spectroscopy properties have been studied in detail and it has been shown to bind well with silver ions. MEAA has also been shown to have high cytotoxicity when combined with laser ablation therapy.Formule :C7H14O5Degré de pureté :90%Couleur et forme :Clear LiquidMasse moléculaire :178.18 g/molAc-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH
CAS :Please enquire for more information about Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C87H125N21O21Degré de pureté :Min. 95%Masse moléculaire :1,801.05 g/molLeptin (126-140) (human)
CAS :Please enquire for more information about Leptin (126-140) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C65H103N15O26Degré de pureté :Min. 95%Masse moléculaire :1,510.6 g/molL-Phenylalanine methyl ester
CAS :Phenylalanine methyl ester is a metabolite of phenylalanine that is formed by the action of the enzyme phenylalaninase. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of pro-inflammatory cytokines such as colony-stimulating factor (CSF) and tumor necrosis factor alpha (TNFα). This drug also inhibits amyloid protein aggregation, a process that causes Alzheimer's disease. Phenylalanine methyl ester has been used in clinical trials for treating infectious diseases. The drug increases the number of white blood cells in the body and stimulates antibody production. Phenylalanine methyl ester binds to sodium citrate and forms stable complexes with hydrogen bonds or ionic interactions.
Formule :C10H13NO2Degré de pureté :Min. 95%Masse moléculaire :179.22 g/molBoc-trans-4-aminocyclohexane acetic acid
CAS :Please enquire for more information about Boc-trans-4-aminocyclohexane acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C13H23NO4Masse moléculaire :257.33 g/mol1-Phenyl-4,5-dihydro-1H-pyrazol-3-amine
CAS :1-Phenyl-4,5-dihydro-1H-pyrazol-3-amine is an organic compound that is used as a reagent in the synthesis of other compounds. It is a dimeric compound that can be synthesized by electrolysis. It has been shown to have kinetic and potential properties, which are determined by its anilines and pyridines. 1-Phenyl-4,5-dihydro-1H-pyrazol-3-amine can also be synthesized from ethanolamine and copper (II) salts. This technique involves the electrochemical oxidation of copper, followed by reduction with acetonitrile. The resulting 1-(aminomethyl)-4,5 dihydro pyrazole 3 amine can then be used for further reactions.Formule :C9H11N3Degré de pureté :Min. 95%Masse moléculaire :161.2 g/molFmoc-D-Cys(Mtt)-OH
CAS :Please enquire for more information about Fmoc-D-Cys(Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C38H33NO4SDegré de pureté :Min. 95%Masse moléculaire :599.74 g/molAc-Phe-Trp-OH
CAS :Please enquire for more information about Ac-Phe-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C22H23N3O4Degré de pureté :Min. 95%Masse moléculaire :393.44 g/molDABCYL-Arg-Gly-Val-Val-Asn-Ala-OH
CAS :Please enquire for more information about DABCYL-Arg-Gly-Val-Val-Asn-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C40H59N13O9Degré de pureté :Min. 95%Masse moléculaire :865.98 g/mol(Lys8)-Conopressin S
CAS :Please enquire for more information about (Lys8)-Conopressin S including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C41H73N15O10S2Degré de pureté :Min. 95%Masse moléculaire :1,000.25 g/mol(Des-Pyr 1,D-Ser(tBu)6,Azagly10)-LHRH acetate salt
CAS :Produit contrôléPlease enquire for more information about (Des-Pyr 1,D-Ser(tBu)6,Azagly10)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C54H79N17O12Degré de pureté :Min. 95%Masse moléculaire :1,158.31 g/molSaposin C (15-32) (rat)
CAS :Please enquire for more information about Saposin C (15-32) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C89H155N21O29Degré de pureté :Min. 95%Masse moléculaire :1,983.31 g/molPACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS :Trifluoroacetate saltFormule :C142H224N40O39SDegré de pureté :Min. 95%Masse moléculaire :3,147.61 g/molH-Trp-Asn-OH
CAS :H-Trp-Asn-OH is a synthetic amino acid with the chemical formula H-Trp-Asn-OH. It has been shown to act as a competitive antagonist of the 5HT3 receptor and can be used in the treatment of diseases such as irritable bowel syndrome, depression, and anxiety. The crystal structure of H-Trp-Asn-OH shows that it is an L type polymerase that contains a carboxy group. The docking studies show that this compound binds to the receptor proteins of the subunits and inhibits fission by triphosphatases, which are enzymes involved in cellular processes such as transcription and protein synthesis.Formule :C15H18N4O4Degré de pureté :Min. 95%Masse moléculaire :318.33 g/molH-Gly-Arg-Gly-Asp-Asn-Pro-OH
CAS :H-Gly-Arg-Gly-Asp-Asn-Pro-OH is a cyclic peptide that is derived from the amino acid sequence of human collagen. It has been shown to have significant cytotoxicity and act as a chemoattractant for cells. H-Gly-Arg-Gly-Asp-Asn-Pro-OH has also been found to stimulate the growth of fibroblasts and increase the production of collagen, which is an important structural protein in connective tissue. HGRAAAP has been shown to have antiinflammatory properties and can be used to treat autoimmune diseases and infectious diseases, such as papillary muscle dysfunction, which is caused by inflammation. HGRAAAP may also be used to inhibit water permeability into cells, which would be helpful for the treatment of certain cancers that are caused by unregulated cell growth.Formule :C23H38N10O10Degré de pureté :Min. 95%Masse moléculaire :614.61 g/molOsteocalcin (7-19) (human)
CAS :Please enquire for more information about Osteocalcin (7-19) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C65H98N16O19Degré de pureté :Min. 95%Masse moléculaire :1,407.57 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS :Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C49H59N12O13PDegré de pureté :Min. 95%Masse moléculaire :1,055.04 g/molH-Ala-Met-OH
CAS :H-Ala-Met-OH is a hydrophobic amino acid. It is found in the sequence of a number of proteins, including hormones and enzymes. The optimum temperature for this amino acid is around 15 degrees Celsius, which is why it can be found in the cocrystallized dodecyl and racemized divalent forms. H-Ala-Met-OH has been shown to have divalent properties due to its ability to bind with two metal ions at the same time. H-Ala-Met-OH also has an amino acid sequence that can be found in many different proteins and enzymes, such as N-acetyl-L-tyrosine. This amino acid has been used as a target for bioinformatics studies on hormone sequences for the reaction mechanism.Formule :C8H16N2O3SDegré de pureté :Min. 95%Masse moléculaire :220.29 g/moltrans-4-Benzyloxy-3-methoxy-beta-nitrostyrene
CAS :Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is an oxime that can be used as a catalyst for the catalytic hydrogenation of nitroalkanes. It is also a precursor to pallimamine, which is used as a pharmaceutical agent and an experimental virucide. Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is synthesized by coupling two indole carboxylic acid analogues in the presence of sodium hydroxide and potassium carbonate. The reaction yields trans-(4'-benzyloxy)-3'-methoxystyrene, which is then converted to the title compound with ammonium chloride and hydrochloric acid. This compound undergoes acidic hydrolysis to yield the title compound.
Formule :C16H15NO4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :285.29 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS :Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C54H85N19O13Degré de pureté :Min. 95%Masse moléculaire :1,208.37 g/molH-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS :Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C29H42N8O4SDegré de pureté :Min. 95%Masse moléculaire :598.76 g/molRF9 trifluoroacetate salt
CAS :RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.Formule :C26H38N6O3Degré de pureté :Min. 95%Masse moléculaire :482.62 g/molZ-Ala-Pro-4MbetaNA
CAS :Please enquire for more information about Z-Ala-Pro-4MbetaNA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C27H29N3O5Degré de pureté :Min. 95%Masse moléculaire :475.54 g/mol
