
Acides aminés (AA)
Les acides aminés (AA) sont les éléments constitutifs fondamentaux des protéines, jouant un rôle crucial dans divers processus biologiques. Ces composés organiques sont essentiels pour la synthèse des protéines, les voies métaboliques et la signalisation cellulaire. Dans cette catégorie, vous trouverez une gamme complète d'acides aminés, y compris des formes essentielles, non essentielles et modifiées, qui sont vitales pour la recherche en biochimie, biologie moléculaire et sciences de la nutrition. Chez CymitQuimica, nous fournissons des acides aminés de haute qualité pour soutenir vos besoins en recherche et développement, garantissant précision et fiabilité dans vos résultats expérimentaux.
Sous-catégories appartenant à la catégorie "Acides aminés (AA)"
- Dérivés d'acides aminés(3.955 produits)
- Acide aminé et composés apparentés aux acides aminés(3.464 produits)
- Acides aminés avec de l'oxygène ou du soufre(168 produits)
- Boc- Acides aminés(351 produits)
- Acides aminés avec groupes protecteurs(1.710 produits)
38247 produits trouvés pour "Acides aminés (AA)"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
(Des-Leu9)-Kinetensin
CAS :<p>(Des-Leu9)-Kinetensin H-Ile-Ala-Arg-Arg-His-Pro-Tyr-Phe-OH is an analog of kinetensin, a peptide hormone that stimulates pancreatic exocrine secretions. (Des-Leu9)-Kinetensin H-Ile-Ala-Arg-Arg-His-Pro-Tyr-Phe has been shown to have a specific interaction with the albumin protein, which is the major plasma protein in humans. This peptide can inhibit protein synthesis and may be used as a treatment for chronic renal failure, cystic fibrosis, malignant hypertension, and other conditions. The sequence of this peptide is homologous to the sequence of human kinetensin. Electron microscopic analysis showed that it has a hydrophobic side chain and an amphipathic structure.</p>Formule :C50H74N16O10Degré de pureté :Min. 95%Masse moléculaire :1,059.22 g/molNeurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt
CAS :<p>Neurotensin is a peptide hormone that regulates the release of other hormones and neurotransmitters, such as dopamine. It has been shown to be able to regulate appetite and bowel disease in animal models. Neurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt is a neurotensin molecule with an acetate group attached to it. This molecule is completely soluble in water and has been shown to have no effect on energy metabolism or polymerase chain reactions.</p>Formule :C78H121N21O20Degré de pureté :Min. 95%Masse moléculaire :1,672.92 g/molGalanin Message Associated Peptide (16-41) amide
CAS :<p>Please enquire for more information about Galanin Message Associated Peptide (16-41) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C134H219N35O37SDegré de pureté :Min. 95%Masse moléculaire :2,944.45 g/molAmyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C44H81N17O16Degré de pureté :Min. 95%Masse moléculaire :1,104.22 g/molH-Phe-Gly-His-p-nitro-Phe-Phe-Ala-Phe-OMe
CAS :<p>H-Phe-Gly-His-p-nitro-Phe-Phe-Ala-Phe-OMe is a protonated amino acid. It has been shown to have a high affinity for the histidine subsite of human thrombin. This compound has been found to have a kinetic rate of hydrolysis that is competitive with that of aspartic acid, but slower than that of valine. H-Phe-Gly-His-p-nitro-Phe--Phe--Ala--Phe--OMe also functions as an anticoagulant and inhibits clotting by inhibiting the conversion of fibrinogen to fibrin.</p>Formule :C48H54N10O10Degré de pureté :Min. 95%Masse moléculaire :931 g/molH-His-His-OH trifluoroacetate salt
CAS :<p>H-His-His-OH trifluoroacetate salt is a compound that has been extensively studied for its potential use in antimicrobial peptides. It is a small molecule that inhibits the activity of enzymes by binding to a specific region on the enzyme's surface, thereby preventing the progression of an essential chemical reaction. H-His-His-OH trifluoroacetate salt has been shown to inhibit protein synthesis in bacteria and yeast cells, as well as in model systems. The inhibition of protein synthesis may be due to hydrogen bonding between the hydroxyl group on His and the amino groups on His. H-His-His-OH trifluoroacetate salt also has an inhibitory effect on enzymes catalysis and can enhance their activity when used with another substrate.</p>Formule :C12H16N6O3Degré de pureté :Min. 95%Masse moléculaire :292.29 g/molH-Glu-Glu-Glu-OH
CAS :<p>H-Glu-Glu-Glu-OH is an amino acid sequence that has been shown to have low toxicity and a high therapeutic index. It is a carboxyl group containing oligopeptide, which can be used as a treatment agent for various conditions. H-Glu-Glu-Glu-OH has an amino group and acidic side chain at the COOH terminus, which is responsible for its protonated form. This protonated form of H-Glu-Glu-Glu-OH binds to the follicle cells in the ovaries, inhibiting them from releasing eggs. The carboxyl terminus of H-Glu-Glu-Glgol OH is deprotonated, which allows it to bind to the cell membrane surface of cancer cells and inhibit their growth by interfering with protein synthesis.</p>Formule :C15H23N3O10Degré de pureté :Min. 95%Masse moléculaire :405.36 g/molAc-Val-Asp-Val-Ala-Asp-aldehyde (pseudo acid)
CAS :<p>Ac-Val-Asp-Val-Ala-Asp-aldehyde is a pseudo acid that is used in molecular modeling and kinetic studies. Ac-Val-Asp-Val-Ala-Asp-aldehyde has been shown to be a potent inhibitor of caspase activity and has been shown to inhibit the activity of various other enzymes as well, including cyclohexane ring hydroxylases and nitroreductases. Ac-Val-Asp-Val-Ala-Asp--aldehyde analogs are being studied for their ability to bind to specific proteins or inhibit enzyme activities. Ac-- Val-- Asp-- Val-- Ala-- Asp-- aldehyde binds to the active site of caspase 3 and prevents it from cleaving its target protein, which leads to cell death.</p>Formule :C23H37N5O10Degré de pureté :Min. 95%Masse moléculaire :543.57 g/mol(Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C31H41N9O7Degré de pureté :Min. 95%Masse moléculaire :651.71 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS :<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C44H76N14O12Degré de pureté :Min. 95%Masse moléculaire :993.16 g/molFmoc-Gly-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Gly-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%GRF (ovine, caprine) trifluoroacetate salt
CAS :<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C221H368N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,121.8 g/molBoc-Ala-Ala-Gly-pNA
CAS :<p>Boc-Ala-Ala-Gly-pNA is a peptide that has been synthesized using the Fmoc/tBu strategy. It has an acidic pH, and its proteolytic activity can be enhanced by the addition of chromogenic or fluorogenic substrates. Boc-Ala-Ala-Gly-pNA is used as a substrate in fingerprint analysis and can be used to identify bacteria such as Proteus mirabilis, Pseudomonas aeruginosa, and Bacillus cereus. This peptide can also be used to identify strains of Escherichia coli, Enterococci, Staphylococci, Streptococci, and Haemophilus influenzae.</p>Formule :C19H27N5O7Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :437.45 g/molBQ-123 Cyclo(-D-Trp-D-Asp-Pro-D-Val-Leu)
CAS :<p>BQ-123 is a cyclic peptide that has been shown to have a binding affinity for the serotonin receptor. The binding of BQ-123 to the receptor leads to a reduction in intracellular calcium concentration, which may be due to the inhibition of serine protease activity. This agent also inhibits the production of tumour necrosis factor-α (TNF-α) and has an inhibitory effect on cardiac contractility.</p>Formule :C31H42N6O7Degré de pureté :Min. 95%Masse moléculaire :610.7 g/molBoc-D-Cys(NPys)-OH
CAS :<p>Please enquire for more information about Boc-D-Cys(NPys)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H17N3O6S2Degré de pureté :Min. 95%Masse moléculaire :375.42 g/molAmylin (20-29) (human)
CAS :<p>Amylin is a peptide hormone that belongs to the group of hormones that include insulin and glucagon. Amylin has been shown to have an anti-diabetic effect in diabetic patients by stimulating insulin secretion and improving insulin sensitivity. Amylin inhibits protein aggregation, which may be due to its ability to form hydrogen bonds with other amyloid protein molecules. The structural biology of amylin has been studied using NMR spectroscopy and silver ions. This molecule has a sequence of H-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser, with a molecular weight of 3,726 Da.</p>Formule :C43H68N12O16Degré de pureté :Min. 95%Masse moléculaire :1,009.07 g/molAc-Ile-Glu-Thr-Asp-pNA
CAS :<p>Ac-Ile-Glu-Thr-Asp-PNA is a synthetic peptide that mimics the amino acid sequence of a region in the protein p67phox, which is a component of the mitochondrial membrane. Ac-Ile-Glu-Thr-Asp-PNA induces apoptosis by activating caspases and inhibiting ATP production. In vitro studies have shown this peptide to be active against hl60 cells, an inflammatory bowel disease cell line, as well as carcinoma cell lines derived from squamous cell carcinoma and carcinoma of the cervix. Ac-Ile-Glu-Thr-Asp-PNA also inhibits inflammatory cytokines such as IL1β, TNFα and IL6, which are associated with chronic inflammation.</p>Formule :C27H38N6O12Degré de pureté :Min. 95%Masse moléculaire :638.62 g/molMca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt
CAS :<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C61H82N16O18Degré de pureté :Min. 95%Masse moléculaire :1,327.4 g/molFmoc-Ala-Cys(Psi(Me ,Me)pro)-OH
<p>Please enquire for more information about Fmoc-Ala-Cys(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C24H26N2O5SDegré de pureté :Min. 95%Masse moléculaire :454.54 g/mol(Tyr0)-Fibrinopeptide A (human)
CAS :<p>Please enquire for more information about (Tyr0)-Fibrinopeptide A (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C72H106N20O28Degré de pureté :Min. 95%Masse moléculaire :1,699.73 g/molLys-(Des-Arg9)-Bradykinin trifluoroacetate salt
CAS :<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>Formule :C50H73N13O11Degré de pureté :Min. 95%Masse moléculaire :1,032.2 g/molH-Ala-Ala-Ala-Tyr-Ala-OH
CAS :<p>Please enquire for more information about H-Ala-Ala-Ala-Tyr-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C21H31N5O7Degré de pureté :Min. 95%Masse moléculaire :465.5 g/molBis(4-methylphenyl) sulfone
CAS :<p>Bis(4-methylphenyl) sulfone is an industrial chemical used in the manufacture of other chemicals. It is a sulfone that contains a hydroxyl group and a methylating agent. The reaction solution must be anhydrous and contain sodium carbonate, chloride, and methylating agent. The product can be synthesized by the Suzuki coupling reaction between an alkyl halide and an aryl boronic acid. This process requires activation energies of about 40-45 kcal/mol to drive the reaction forward. The hydrochloric acid reacts with the hydroxyl group on the sulfone to form a chlorosulfonic acid intermediate, which reacts with methylene chloride to produce bis(4-methylphenyl) sulfone. The carbonyl group on this intermediate is activated by adding methoxy groups, which are then replaced by chlorine atoms in order to form bis(4-chlorophenyl) sulfone.</p>Formule :C14H14O2SDegré de pureté :Min. 95%Masse moléculaire :246.33 g/mol(D-Pro2,D-Trp6·8, Nle 10)-Neurokinin B
CAS :<p>Please enquire for more information about (D-Pro2,D-Trp6·8, Nle 10)-Neurokinin B including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C67H87N15O14Degré de pureté :Min. 95%Masse moléculaire :1,326.5 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS :<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>Formule :C23H34N6O9Degré de pureté :Min. 95%Masse moléculaire :538.55 g/molGly-Gly-OMe·HCl
CAS :<p>Gly-Gly-OMe·HCl is a diagnostic agent that can be used to diagnose atherosclerotic lesions. It is conjugated to an organic molecule and then radiolabeled. The conjugate can be detected by cyclopentadienyl, which emits gamma rays when it decays. This conjugate has been shown to selectively accumulate in atherosclerotic lesions of the coronary arteries, where it accumulates with a higher concentration than in the surrounding tissue. This product also has gastroprotective effects on the stomach and liver and can reduce lipid levels in hyperlipidaemic patients.</p>Formule :C5H10N2O3•HClDegré de pureté :Min. 95 Area-%Couleur et forme :Slightly Rose PowderMasse moléculaire :182.61 g/molFmoc-D-Tyr(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Tyr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%1,2-Phenylene phosphorochloridite
CAS :<p>1,2-Phenylene phosphorochloridite is a chemical that is an intermediate for the synthesis of perfluorinated compounds. It has been used as a precursor for the synthesis of biodiesel. The proton NMR spectrum shows three resonances: one at δ 3.8 ppm (J = 6 Hz) corresponding to the protons on the aromatic ring, one at δ 4.7 ppm (J = 6 Hz) corresponding to the protons on the chloro group, and one at δ 7.6 ppm (J = 2 Hz) corresponding to the protons on the methylene chain. This chemical can be prepared by reacting trifluoroacetic acid with phenol in a preparative method with nucleophilic substitution or by dehydrating fatty alcohols with halides in a dehydration reaction.</p>Formule :C6H4ClO2PDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :174.52 g/molH-Leu-Leu-Leu-NH2
CAS :<p>Please enquire for more information about H-Leu-Leu-Leu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C18H36N4O3Degré de pureté :Min. 95%Masse moléculaire :356.5 g/molSuc-Ala-Ala-Pro-Ile-pNA
CAS :<p>Suc-Ala-Ala-Pro-Ile-pNA is an enzyme that belongs to the family of zymogens. It is a tetrapeptide that is synthesized in the cytosol and transported into the lumen of the intestine, where it is cleaved by trypsin to form pepsin A. In humans, this enzyme has been localized to the duodenum and jejunum. Suc-Ala-Ala-Pro-Ile-pNA is activated by trypsin and cleaves proteins at their carboxyl side chains. It also binds to specific residues in proteins, including those with unpaired cysteine residues.</p>Formule :C27H38N6O9Degré de pureté :Min. 95%Masse moléculaire :590.63 g/molAc-Tyr-OEt
CAS :<p>Ac-Tyr-OEt is a synthetic peptide with the amino acid sequence Ac-Tyr-OEt. It is a signal peptide that enhances the efficiency of protein secretion in soybean cells. It binds to hydroxyl groups on sephadex g-100, which may be due to hydrogen bonding between the two. The rate constant for this reaction has been measured at 2.5 x 10^6 M^(-1)s^(-1) and the caproic acid concentration for half-maximal binding has been determined to be 3 mM. Ac-Tyr-OEt also has protease activity, as demonstrated by its ability to hydrolyze carboxypeptidase A at a rate of 1.7 x 10^4 min^(-1).</p>Formule :C13H17NO4Degré de pureté :Min. 95%Masse moléculaire :251.28 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS :<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C63H113N22O25PSDegré de pureté :Min. 95%Masse moléculaire :1,641.74 g/molZ-Val-Leu-OH
CAS :<p>Z-Val-Leu-OH is a model substrate for plant proteases, aminopeptidases and dipeptidases. It has been used as a standard to study the mechanism of hydrolysis by these enzymes. Z-Val-Leu-OH is hydrolyzed by these enzymes at optimally pH 8.0, with the rate increasing with temperature up to 45°C. The hydrolysis of Z-Val-Leu-OH by germination endosperm proteinase is inhibited by hemoglobin, which leads to increased levels of peptides in the endosperm.</p>Formule :C19H28N2O5Degré de pureté :Min. 95%Masse moléculaire :364.44 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C195H300N56O56SDegré de pureté :Min. 95%Masse moléculaire :4,356.88 g/molOsteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C27H41N9O8Degré de pureté :Min. 95%Masse moléculaire :619.67 g/molNeuromedin N trifluoroacetate salt
CAS :<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formule :C38H63N7O8Degré de pureté :Min. 95%Masse moléculaire :745.95 g/molFmoc-p-nitro-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%O-a-Hippuryl-L-argininic acid hydrochloride salt
CAS :<p>Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C15H20N4O5Degré de pureté :Min. 95%Masse moléculaire :336.34 g/molFmoc-Leu-Pro-OH
CAS :<p>Fmoc-Leu-Pro-OH is a benzyl ester that can be used in peptide synthesis. It can be used to remove the benzyl protecting group from the amino acids leucine, proline, and hydroxyproline. Fmoc-Leu-Pro-OH is also capable of cleaving dipeptides and octapeptides. The benzyl ester can be deprotected using anisole and accelerates the reaction. This reagent is irreversible, so it cannot be reused.</p>Formule :C26H30N2O5Degré de pureté :Min. 95%Masse moléculaire :450.53 g/mol(D-Arg1,D-Phe5,D-Trp7·9,Leu11)-Substance P
CAS :<p>Substance P is a neuropeptide that binds to the tachykinin receptor NK1. It has potent anti-inflammatory and mitogenic activities, which are mediated through its binding to the NK1 receptor. Substance P can stimulate lung cancer cells to proliferate and inhibit their apoptosis, which may be due to an autocrine mechanism. In addition, it has been shown that substance P can potentiate the growth of some cancers such as colon cancer in vitro and in vivo by increasing DNA synthesis and cell proliferation. This peptide also has a dose-dependent effect on cell growth, with high doses inhibiting cell proliferation at higher levels than low doses.</p>Formule :C79H109N19O12Degré de pureté :Min. 95%Masse moléculaire :1,516.83 g/molH-D-Glu(Trp-OH)-OH
CAS :<p>H-D-Glu(Trp-OH)-OH is a synthetic peptide that has been shown to inhibit the replication of the herpes simplex virus (HSV). It binds to toll-like receptor 3 and 4 on cells, which may inhibit HSV replication. This compound has also been shown to be a potent inhibitor of HIV, as well as hepatitis B and C. H-D-Glu(Trp-OH)-OH has been shown to cause lung damage in mice. The mechanism for this effect is unknown, but it may involve an increase in reactive oxygen species or other cell signaling pathways.</p>Formule :C16H19N3O5Degré de pureté :Min. 95%Masse moléculaire :333.34 g/molZ-Gly-Gly-Ala-OH
CAS :<p>Please enquire for more information about Z-Gly-Gly-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C15H19N3O6Degré de pureté :Min. 95%Masse moléculaire :337.33 g/molDnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt
CAS :<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>Formule :C52H77N17O14Degré de pureté :Min. 95%Masse moléculaire :1,164.27 g/molGRF (1-29) amide (human) acetate salt
CAS :<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formule :C149H246N44O42SDegré de pureté :Min. 95%Masse moléculaire :3,357.88 g/molH-His-Lys-OH·HBr
CAS :<p>Please enquire for more information about H-His-Lys-OH·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C12H21N5O3·HBrDegré de pureté :Min. 95%Masse moléculaire :364.24 g/molFibronectin Adhesion-Promoting Peptide trifluoroacetate salt
CAS :<p>Fibronectin Adhesion-Promoting Peptide trifluoroacetate salt H-Trp-Gln-Pro-Pro-Arg-Ala-Arg-Ile-OH trifluoroacetate salt (FAP) is a synthetic peptide that promotes fibronectin adhesion. It binds to the amino acid sequence in the C terminal end of fibronectin, which is known to be responsible for binding to actin filaments and growth factors. FAP has been shown to promote wound healing by stimulating the proliferation of corneal epithelial cells in vitro. The mechanism of action of FAP may be due to its ability to bind to chloride ions, which are involved in the regulation of cell proliferation and migration.</p>Formule :C47H74N16O10Degré de pureté :Min. 95%Masse moléculaire :1,023.19 g/mol(Ala2)-Leu-Enkephalin
CAS :<p>Leu-enkephalin is an opioid peptide that is a neurotransmitter in the brain. It is synthesized from the proenkephalin precursor and acts on δ-opioid receptors and kappa-opioid receptors. Leu-enkephalin has been shown to have physiological effects such as analgesia, hypothermia, hyperalgesia, and decreased gastrointestinal motility. Leu-enkephalin also inhibits voltage-dependent calcium channels in neuronal cells by binding to them with high affinity. The binding of leu-enkephalin to these channels affects their function and leads to neuronal death. Disulfide bonds are formed between cysteine residues on leu-enkephalin to stabilize this protein's structure.</p>Formule :C29H39N5O7Degré de pureté :Min. 95%Masse moléculaire :569.65 g/molKR-12 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C71H127N25O15Degré de pureté :Min. 95%Masse moléculaire :1,570.93 g/molFmoc-D-Pen (Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Pen (Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Leu-Enkephalin (sulfated)
CAS :<p>Leu-Enkephalin (sulfated) H-Tyr(SO3H)-Gly-Gly-Phe-Leu-OH is an endogenous opioid peptide that has been found in the central nervous system. It was first discovered by radioimmunoassays of brain tissue and then later found to be present in other tissues. Leu-enkephalin is not acidic, but it can form a salt with sulfonic acid or carboxylate, which may account for its ability to bind to receptors on cell membranes. The molecular weight of leu-enkephalin is 921.5 daltons and it contains one sulfonation group and one glycosylation site. Leu-enkephalin (sulfated) H-Tyr(SO3H)-Gly-Gly-Phe-Leu-OH can be synthesized from the amino acids Glycine, Tyr(SO</p>Formule :C28H37N5O10SDegré de pureté :Min. 95%Masse moléculaire :635.69 g/molH-Gly-Arg-Gly-Asp-OH
CAS :<p>H-Gly-Arg-Gly-Asp-OH is a cyclic peptide with the amino acid sequence of Gly-Arg-Gly-Asp. It has been shown to promote bone formation and inhibit bone resorption in vitro by stimulating the release of growth factors. This peptide can be used as a diagnostic agent for monitoring cell culture, which may be due to its ability to bind monoclonal antibodies. H-Gly-Arg-Gly-Asp-OH also has the ability to form conjugates with polymerase chain reaction (PCR) probes or other biomolecules. These conjugates can be used for detecting specific DNA sequences, such as those found in mammalian cells.</p>Formule :C14H25N7O7Degré de pureté :Min. 95%Masse moléculaire :403.39 g/mol1-Methyl-1H-imidazole-5-boronic acid pinacol ester
CAS :<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C10H17BN2O2Degré de pureté :Min. 95%Masse moléculaire :208.07 g/mol(Des-octanoyl)-Ghrelin (human) acetate salt
CAS :<p>Acetate salt</p>Formule :C141H235N47O41·xC2H4O2Degré de pureté :Min. 95%Masse moléculaire :3,244.67 g/molTyr-Leptin (26-39) (human)
CAS :<p>Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C80H137N19O25Degré de pureté :Min. 95%Masse moléculaire :1,765.06 g/molNeurokinin B trifluoroacetate salt
CAS :<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br><br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>Formule :C55H79N13O14S2Degré de pureté :Min. 95%Masse moléculaire :1,210.43 g/mol(Met(O)35)-Amyloid b-Protein (1-42)
CAS :<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C203H311N55O61SDegré de pureté :Min. 95%Masse moléculaire :4,530.04 g/mol4-Methylsulphonylaniline
CAS :<p>4-Methylsulphonylaniline is a reactive compound that can be used as an anticancer agent. It is a quinoline derivative and has been found to have potent antitumor activity against various cancer cell lines, including those resistant to other anticancer agents. The activation energy of this compound is high at 93 kcal/mol and it has been found to react with dimethylformamide (DMF) in the reaction mechanism. 4-Methylsulphonylaniline has also been shown to inhibit the growth of tumor cells in mice by inhibiting DNA synthesis. This molecule also causes DNA damage in cultured cells. 4-Methylsulphonylaniline may also cause environmental pollution because it reacts with sulfadiazine, which is a drug used for the treatment of chronic infections caused by bacteria such as Salmonella typhi and Mycobacterium tuberculosis, leading to the release of methyl sulfone, which can be toxic to aquatic</p>Formule :C7H9NO2SDegré de pureté :Min. 95%Masse moléculaire :171.22 g/molTyrosinase (206-214) (human) acetate salt
CAS :<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formule :C61H83N15O10Degré de pureté :Min. 95%Masse moléculaire :1,186.41 g/mol(Pro34)-Peptide YY (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C194H294N54O56Degré de pureté :Min. 95%Masse moléculaire :4,278.74 g/molFluorogenic Human CMV Protease Substrate trifluoroacetate salt
CAS :<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C73H109N23O18SDegré de pureté :Min. 95%Masse moléculaire :1,628.86 g/molZ-Val-Ala-Asp-AMC
CAS :<p>Z-Val-Ala-Asp-AMC is a photoactive peptide that is activated by light exposure. This drug has cytostatic and cardiotoxic effects, which may be due to its ability to induce autophagy. Z-Val-Ala-Asp-AMC induces cell death in cancer cells through the activation of caspase independent pathways. It also inhibits nitroprusside induced apoptosis in cultured skin cells, suggesting that it may have therapeutic potential for the treatment of cancer.</p>Formule :C30H34N4O9Degré de pureté :Min. 95%Masse moléculaire :594.61 g/molHippuryl-Cys(2-aminoethyl)-OH hydrochloride salt
CAS :<p>Please enquire for more information about Hippuryl-Cys(2-aminoethyl)-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C14H19N3O4SDegré de pureté :Min. 95%Masse moléculaire :325.38 g/molTyrosinase (243-251) (human) acetate salt
CAS :<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formule :C44H68N10O18S2Degré de pureté :Min. 95%Masse moléculaire :1,089.2 g/mol(Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C139H231N45O41Degré de pureté :Min. 95%Masse moléculaire :3,188.6 g/molNeurotensin (8-13)
CAS :<p>Neurotensin is a peptide that regulates the activity of the hypothalamus and pituitary gland. Neurotensin is synthesized from prepro-neurotensin, which is cleaved to produce neurotensin (8-13) H-Arg-Arg-Pro-Tyr-Ile-Leu-OH. It is a member of the tachykinins family of neuropeptides, which are characterized by a conserved disulfide bond. Neurotensin has been shown to increase locomotor activity in mice and rats and may be involved in pain perception. Neurotensin also binds to receptors on nerve cells, including the enkephalin receptor, with high affinity. This binding leads to an inhibition of release of neurotransmitters such as dopamine, serotonin, and acetylcholine by neurons.</p>Formule :C38H64N12O8Degré de pureté :Min. 95%Masse moléculaire :816.99 g/molZ-Phe-Gly-Phe-Gly-OH
CAS :<p>Please enquire for more information about Z-Phe-Gly-Phe-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C30H32N4O7Degré de pureté :Min. 95%Masse moléculaire :560.6 g/molSuc-Ala-Pro-Ala-AMC
CAS :<p>Suc-Ala-Pro-Ala-AMC is a synthetic peptide that is used as a fluorescent substrate to measure the activity of serine proteases. It is used in plant physiology and has been shown to be effective in the treatment of inflammatory diseases. Suc-Ala-Pro-Ala-AMC is an acidic molecule with a pKa of 3.1. This means it can exist as both a zwitterion, with a positive charge on one end and negative charge on the other, or as an ionized molecule with both ends having a negative charge. The zwitterionic form is more stable than the ionized form at low pH levels and will therefore be present at higher concentrations at lower pH values. Suc-Ala-Pro-Ala-AMC shows proteolytic activity against peptidases such as papain, bromelain, trypsin, and chymotrypsin. It also binds to neutroph</p>Formule :C25H30N4O8Degré de pureté :Min. 95%Masse moléculaire :514.53 g/molH-Gly-Gly-Ala-Gly-OH
CAS :<p>Glycylglycine is a tetrapeptide antibiotic that belongs to the group of antibiotics. It is expressed in E. coli and has been shown to inhibit the growth of other bacteria through binding to metal ions, such as magnesium, which are necessary for their survival. Glycylglycine has also been shown to have a kinetic method with a high rate of inhibition. This compound was synthesized by an electrospray ionization process, and its enantiomeric form was detected using a spectrometer. The molecule has been found to be an overgrowth inhibitor in analytical chemistry studies.</p>Formule :C9H16N4O5Degré de pureté :Min. 95%Masse moléculaire :260.25 g/molNeuropeptide Y (free acid) (human, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C189H284N54O58SDegré de pureté :Min. 95%Masse moléculaire :4,272.67 g/molH-Ala-Ala-Ala-OH
CAS :<p>H-Ala-Ala-Ala-OH is a synthetic peptide that has been shown to inhibit protease activity and is being investigated as a potential treatment for chronic arthritis. This peptide has been shown to be effective in the removal of nitrogen from wastewater. The conformational properties of H-Ala-Ala-Ala-OH are similar to those of the human serum amide, which is thought to have an antiarthritic effect and may also act as a model system for other peptides. H-Ala-Ala-Ala-OH has also been shown to have enzyme activities, including dihedral and structural analysis.</p>Formule :C9H17N3O4Degré de pureté :Min. 95%Masse moléculaire :231.25 g/molIDR-1 trifluoroacetate salt
CAS :<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>Formule :C65H118N18O15Degré de pureté :Min. 95%Masse moléculaire :1,391.74 g/molH-DL-Val-Leu-Arg-pNA acetate salt
CAS :<p>H-DL-Val-Leu-Arg-pNA acetate salt is a natriuretic that is used to treat chronic kidney failure. It has an inhibitory effect on serine protease and epidermal growth factor, which are enzymes involved in the production of atrial natriuretic peptide (ANP). The drug also reduces blood pressure by inhibiting the activity of angiotensin II, which is a potent vasoconstrictor. H-DL-Val-Leu-Arg-pNA acetate salt has been shown to increase urea nitrogen levels by inhibiting the activity of alkaline phosphatase, which breaks down ammonia in the liver.</p>Formule :C23H38N8O5Degré de pureté :Min. 95%Masse moléculaire :506.6 g/molAc-Leu-Glu-Val-Asp-AFC
CAS :<p>Please enquire for more information about Ac-Leu-Glu-Val-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C32H40F3N5O11Degré de pureté :Min. 95%Masse moléculaire :727.68 g/molH-β-Cyclohexyl-Ala-OMe·HCl
CAS :<p>Please enquire for more information about H-beta-Cyclohexyl-Ala-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C10H19NO2·HClDegré de pureté :Min. 95%Masse moléculaire :221.72 g/molNeuronostatin-19 (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C91H153N29O26Degré de pureté :Min. 95%Masse moléculaire :2,069.37 g/molTIMP-2 (145-168) (human, bovine) trifluoroacetate salt
<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C131H189N33O35S3Degré de pureté :Min. 95%Masse moléculaire :2,882.3 g/mol(D-Lys6)-LHRH (free acid) acetate salt
CAS :Produit contrôlé<p>Please enquire for more information about (D-Lys6)-LHRH (free acid) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C59H83N17O14Degré de pureté :Min. 95%Masse moléculaire :1,254.4 g/molFmoc-Cys(NPys)-OH
CAS :<p>Fmoc-Cys(NPys)-OH is a disulfide with a cyclic structure that can be used in the synthesis of peptides. It reacts efficiently with thiols to form stable, covalent bonds and can be used as an efficient ligation reagent for cyclic peptides. Fmoc-Cys(NPys)-OH is also useful for the synthesis of biomolecules because it has a systematic nature and does not react with other reactive groups on the molecule. It has been shown to have high reactivity towards oxytocin, which is important for its function in triggering labor contractions.</p>Formule :C23H19N3O6S2Degré de pureté :Min. 95%Couleur et forme :White SolidMasse moléculaire :497.55 g/mol2-Methyl-3-(3,4-methylenediOxyphenyl)prOpanal
CAS :Produit contrôlé<p>2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde (2MMPP) is a minor constituent of piperonal. It has been shown to be a potent inhibitor of intracellular calcium levels in humans and rat prostate cancer cells. The mechanism of action is thought to be through an interaction with fatty acid receptors and alterations in cytosolic calcium levels. 2MMPP has been found to act as an odorant binding agent that binds to the olfactory receptor OR5AN1 and alters its function. 2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde has also been shown to have high electrochemical impedance spectroscopy values, which may indicate its ability to remove organic contaminants from wastewater treatment systems.</p>Formule :C11H12O3Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :192.21 g/molExendin-3
CAS :<p>Please enquire for more information about Exendin-3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C184H282N50O61SDegré de pureté :Min. 95%Masse moléculaire :4,202.57 g/molH-Asn-AMC trifluoroacetate salt
CAS :<p>Please enquire for more information about H-Asn-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C14H15N3O4Degré de pureté :Min. 95%Masse moléculaire :289.29 g/mol(Des-Gly10,D-Leu6,[13C6]Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Leu6,[13C6]Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Z-His-Lys(Boc)-OH
CAS :<p>Please enquire for more information about Z-His-Lys(Boc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C25H35N5O7Degré de pureté :Min. 95%Masse moléculaire :517.57 g/molpTH (44-68) (human)
CAS :<p>Please enquire for more information about pTH (44-68) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C117H199N41O41Degré de pureté :Min. 95%Masse moléculaire :2,836.08 g/molH-Gly-Ala-Hyp-OH
CAS :<p>Please enquire for more information about H-Gly-Ala-Hyp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C10H17N3O5Degré de pureté :Min. 95%Masse moléculaire :259.26 g/molH-Thr(Ac)-OH·HCl
CAS :<p>Please enquire for more information about H-Thr(Ac)-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C6H11NO4·HClDegré de pureté :Min. 95%Masse moléculaire :197.62 g/molEnantio-PAF C-16
CAS :<p>Enantio-PAF C-16, or 3-O-Hexadecyl-2-O-acetyl-sn-glycero-1-phosphocholine, is a biologically inactive enatiomer of platelet-activating factor (PAF). It is a PAF receptor agonist.</p>Formule :C26H54NO7PDegré de pureté :Min. 95%Masse moléculaire :523.68 g/molMethyl 3-amino-2-phenylpropanoate HCl
CAS :<p>Methyl 3-amino-2-phenylpropanoate HCl is a chemical intermediate that is synthesized in the biosynthesis of scopolamine and tenellin. It has been found to be an isotopically labeled analog of tropane alkaloids, which are a class of natural products that includes atropine, hyoscyamine, and scopolamine. Methyl 3-amino-2-phenylpropanoate HCl is one of many compounds that can provide structural insights into the biosynthesis and metabolism of these compounds.</p>Formule :C10H13NO2·HClDegré de pureté :Area-% Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :215.68 g/molH-Asp(Gly-OH)-OH
CAS :<p>Polymyxin B is a polycationic antibiotic that has been used in the treatment of infectious diseases and as an ophthalmic ointment. It is effective against bacteria, fungi, and parasites. Polymyxin B exhibits antimicrobial activity by binding to microbial membranes and causing lysis. The redox potential of this antibiotic is low, which can make it difficult for it to penetrate into cells. Oral cephalosporins are acidic drugs that are poorly absorbed from the gastrointestinal tract; they are only active in the distal small intestine and colon. Streptococcus faecalis is a bacterium that causes infections in the upper respiratory tract and urinary tract. Polymyxin B may be used as an oral agent to treat these infections because it does not require acidity for activity. This drug also exhibits anti-inflammatory effects through its ability to inhibit gamma-aminobutyric acid (GABA) synthesis in bowel cells, which leads to decreased inflammation.</p>Formule :C6H10N2O5Degré de pureté :Min. 95%Masse moléculaire :190.15 g/molDABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt
CAS :<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>Formule :C61H76N12O14SDegré de pureté :Min. 95%Masse moléculaire :1,233.39 g/molAc-Ala-α-naphthyl ester
CAS :<p>Ac-Ala-alpha-naphthyl ester is a chemical compound that belongs to the class of aromatic esters. It is used as a research and benchmarking agent in the measurement of skin penetration potential. Ac-Ala-alpha-naphthyl ester has been shown to have good skin penetration properties, with no adverse effects on the skin.</p>Formule :C15H15NO3Degré de pureté :Min. 95%Masse moléculaire :257.28 g/molAmyloid P Component (33-38) amide trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C37H56N10O7SDegré de pureté :Min. 95%Masse moléculaire :784.97 g/molDnp-Pro-Gln-Gly-Ile-Ala-Gly-Gln-D-Arg-OH
CAS :<p>Dnp-Pro-Gln-Gly-Ile-Ala-Gly-Gln-D-Arg-OH is an activated form of DNP that has been proteolyzed and then carbonylated. It has a ph optimum of 10.5, is reactive in tissue culture, and reacts with collagen. This molecule has clinical response in women, and also shows low expression in human serum. The carbonyl group may be used as a synthetic substrate to generate antibodies against the protein or modified forms of the protein.</p>Formule :C40H61N15O15Degré de pureté :Min. 95%Masse moléculaire :992 g/mol1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole
CAS :<p>Please enquire for more information about 1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C10H17BN2O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :208.07 g/molL-Lysine diisocyanate
CAS :<p>L-Lysine diisocyanate is an organic compound that is a reactive site for the production of calcium stearate and ethylene diamine. It has been shown to be a reactive site in vitro, but not in vivo. L-Lysine diisocyanate reacts with water vapor to produce hydrogen cyanide, which is toxic to cells. The presence of l-lysine can inhibit the formation of hydrogen cyanide, but it also inhibits uptake into cells and tissue cultures.</p>Formule :C8H10N2O4Degré de pureté :Min. 95 Area-%Masse moléculaire :198.18 g/molZ-Ala-Ala-NH2
CAS :<p>Z-Ala-Ala-NH2 is a peptide that has been modified. Z-Ala-Ala-NH2 is a hydrolase and has the ability to hydrolyze peptides. It can be used in organic solvents as an unmodified hydrolase, or it can be modified with a nucleophile (such as an amine) to produce an active hydrolase. The unmodified form of Z-Ala-Ala-NH2 has been shown to have high yields and specificity for peptidyl substrates. This modification is also useful for the synthesis of amide bonds in peptides, which are more stable than ester bonds.</p>Formule :C14H19N3O4Degré de pureté :Min. 95%Masse moléculaire :293.32 g/molBoc-Ala-Gly-Gly-OH
CAS :<p>Boc-Ala-Gly-Gly-OH is a reactive compound that can be used to synthesize antibiotics. It can be used for the production of diazide, which is an antibiotic that inhibits bacterial growth by binding to DNA and preventing its replication. Boc-Ala-Gly-Gly-OH also has been used for the preparation of urethanes, which are used as coatings for medical devices or catheters. This compound is chiral and has been shown to have stereogenic properties in catalytic asymmetric epoxidation reactions.</p>Formule :C12H21N3O6Degré de pureté :Min. 95%Masse moléculaire :303.31 g/molZ-Ala-Ala-Asn-AMC
CAS :<p>Z-Ala-Ala-Asn-AMC is a molecule that is an analog of the amino acid alanine. It has been shown to be effective in inhibiting cancer cell viability and inducing apoptosis in MDA-MB-231 breast cancer cells, which can inhibit tumor growth. This molecule also inhibits protease activity, protein synthesis, and tubule cell proliferation. Z-Ala-Ala-Asn-AMC has applicability in the treatment of cancers and inflammatory diseases.</p>Formule :C28H31N5O8Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :565.57 g/molSuc-Ala-Trp-Pro-Phe-pNA
CAS :<p>Suc-Ala-Trp-Pro-Phe-pNA is a cyclosporine analog that inhibits the activity of protein isomerases. It has been shown to inhibit the phosphatase activity of casein and stabilize peptide bonds in bovine serum albumin. Suc-Ala-Trp-Pro-Phe-pNA can also be used as a substrate for tyrosine kinase and amide bond formation. Suc-Ala-Trp-Pro-Phe-pNA is an inhibitor of FK506 binding to its receptor, which may be due to its ability to compete with tyrosine residues for binding sites. This compound also exhibits stabilization effects on protein structures by inhibiting the degradation of proteins by proteolytic enzymes or other chemical agents.</p>Formule :C38H41N7O9Degré de pureté :Min. 95%Masse moléculaire :739.77 g/mol(D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt
CAS :<p>Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.</p>Formule :C60H87N19O13Degré de pureté :Min. 95%Masse moléculaire :1,282.45 g/mol
