Acides aminés (AA)

<p>Please enquire for more information about (D-Lys6)-LHRH (free acid) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-His(Bzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TRH is a hormone that regulates the metabolic rate and stimulates the pancreas to release insulin. It also has been shown to be involved in regulating locomotor activity and is used in clinical trials for its potential therapeutic effects on Alzheimer’s disease. TRH binds to receptors on gland cells where it activates adenylate cyclase and increases intracellular levels of cAMP, which leads to an increase in cytosolic calcium concentration. TRH also binds to receptors on nerve cells and causes these cells to release neurotransmitters such as dopamine and serotonin. TRH is synthesized by the thyroid gland, pituitary gland, hypothalamus, or other tissues in response to stress or illness. TRH can be administered orally or injected intravenously; it is not active when taken orally because it is broken down by digestive enzymes before reaching the systemic circulation.</p>

<p>H-Tyr-Gln-OH is a model system for the study of polymerase chain reactions. It is a basic protein that has been shown to have antimicrobial peptide activity, and it can be used as a light signal in colony-stimulating factor experiments. H-Tyr-Gln-OH also has been shown to affect fertility in mice and to alter the frequency shift of light. The plant physiology studies on H-Tyr-Gln-OH have revealed that this molecule can stimulate epidermal growth factor production in plants, which may be due to its ability to bind lipid kinases. H-Tyr-Gln-OH can also be used as an antigen for antibody production or as a hybridization probe for DNA detection.</p>

<p>Please enquire for more information about Fibronectin Receptor Peptide (124-131) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-DL-Phe-pNA is a synthetic derivative of the natural substrate Ac-Lys-pNA. It binds to the active site of serine proteases and blocks the release of their active form, which results in inhibition of collagen synthesis. The reaction is reversible and it can be hydrolyzed by chymotrypsin or elastase. Ac-DL-Phe-pNA has been shown to inhibit protein–protein interactions between epimastigotes and extracellular matrix proteins, leading to cell death. This compound has also been found to have an optimum pH of 6.5, which is neutral.</p>

<p>Allatostatin II is a fatty acid that has been shown to have receptor activity. It is an analog of the glycopeptide antibiotic gramicidin S and has been shown to inhibit the growth of bacteria and fungi. Allatostatin II also has diagnostic properties, which are used in biochemical tests for inflammatory diseases. The molecule is conjugated with various agents to form diagnostic agents or antibiotics, such as stenotrophomonas maltophilia and erythromycin. Allatostatin II is found in the human plasma, but its function is unknown.</p>

<p>1,9-Dimethyl-methylene blue zinc chloride double salt is a fluorescent dye that has been used in the study of hyaluronic acid and mesenchymal stem cells. The compound absorbs light at a wavelength of 580 nm, which is the same as the absorption wavelength for hyaluronic acid and mesenchymal stem cells. 1,9-Dimethyl-methylene blue zinc chloride double salt can be used to measure the amount of these compounds in tissues. This dye also shows sensitivity to artifacts such as hemolysis and lipemia, making it useful for research purposes.</p>

<p>L-Lysine diisocyanate is an organic compound that is a reactive site for the production of calcium stearate and ethylene diamine. It has been shown to be a reactive site in vitro, but not in vivo. L-Lysine diisocyanate reacts with water vapor to produce hydrogen cyanide, which is toxic to cells. The presence of l-lysine can inhibit the formation of hydrogen cyanide, but it also inhibits uptake into cells and tissue cultures.</p>

<p>Please enquire for more information about 1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-Boc-pyrrolidine-2,4-dione including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-D-Val-OH is a nonpolar amino acid that belongs to the group of amino acids. It is one of the 20 standard amino acids used by living cells and is found in proteins. The nitrogen atoms are located at the corners of a rectangle and are involved in hydrogen bonding. H-Gly-D-Val-OH is a component of fatty acids, which are molecules that form an important part of the human diet. Fatty acids are taken up by cells through endocytosis and metabolized within the cell cytoplasm by catabolism or anabolism. H-Gly-D-Val-OH has been shown to have kinetic properties in vitro and can be used as a ternary complex forming agent with glycine and D,L-valine when mixed with water. H Gly D Val OH also acts as a cyclic peptide, which can be synthesized from H Gly D Val OH with the help of</p>

<p>Please enquire for more information about (D-Ser6,Azagly10)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Fmoc-L-gamma-carboxyglutamic acid gamma,gamma-di-t-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>

<p>Please enquire for more information about H-Arg-4MbetaNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-t-Boc-piperidine-4-spiro-5'-[1',3'-bis-t-boc]-hydantoin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Polymyxin B is a polycationic antibiotic that has been used in the treatment of infectious diseases and as an ophthalmic ointment. It is effective against bacteria, fungi, and parasites. Polymyxin B exhibits antimicrobial activity by binding to microbial membranes and causing lysis. The redox potential of this antibiotic is low, which can make it difficult for it to penetrate into cells. Oral cephalosporins are acidic drugs that are poorly absorbed from the gastrointestinal tract; they are only active in the distal small intestine and colon. Streptococcus faecalis is a bacterium that causes infections in the upper respiratory tract and urinary tract. Polymyxin B may be used as an oral agent to treat these infections because it does not require acidity for activity. This drug also exhibits anti-inflammatory effects through its ability to inhibit gamma-aminobutyric acid (GABA) synthesis in bowel cells, which leads to decreased inflammation.</p>

<p>1-Methylpiperidine-4-carboxylic acid hydrochloride is a betaine. Betaines are intermediates in the biosynthesis of phosphocholine, which is an important component of all cell membranes. 1-Methylpiperidine-4-carboxylic acid hydrochloride has been analyzed and quantified in fruits and plants such as beets, bananas, oranges, and tomatoes. It can be found in the roots of plants and has been shown to inhibit abiotic stress. This compound is also present in the human body as a result of its ingestion from food sources. 1-Methylpiperidine-4-carboxylic acid hydrochloride inhibits proline synthesis by competing with glycine for the enzyme choline acetyltransferase. It also inhibits synthesis of pipecolic acid (a precursor for histamine) by competing with glycine for the enzyme choline acetyltransferase.</p>

<p>Please enquire for more information about 1-Boc-5-Cyano-3-hydroxymethylindole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Ala-Hyp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FA-Ala-Lys-OH is a lysine derivative with a molecular weight of 243.2 daltons and a pKa of 6.5. It has been shown to be biologically active in humans and animals, and can be used as an amino acid supplement for patients with liver disease or kidney failure who require dialysis. FA-Ala-Lys-OH binds to the creatine kinase receptor on the surface of cells and causes cell lysis, which may be due to its ability to bind to the enzyme's allosteric site. This compound also has anti-viral properties, inhibiting the growth of recombinant virus mcf-7 in vitro by binding to erythrocyte membranes and disrupting protein synthesis. The 6-Fluoro-3-indoxyl beta D galactopyranoside is an antituberculosis drugs that belongs to the class of rifamycins. Rifapentine inhibits bacterial</p>

<p>Please enquire for more information about Cyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Phe-Phe-Asn-Tyr-Tyr-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 3-amino-2-phenylpropanoate HCl is a chemical intermediate that is synthesized in the biosynthesis of scopolamine and tenellin. It has been found to be an isotopically labeled analog of tropane alkaloids, which are a class of natural products that includes atropine, hyoscyamine, and scopolamine. Methyl 3-amino-2-phenylpropanoate HCl is one of many compounds that can provide structural insights into the biosynthesis and metabolism of these compounds.</p>

<p>Please enquire for more information about H-Arg-Gly-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-beta-Ala-Gly-OH is a monoclinic crystalline compound. It is soluble in water and slightly soluble in ethanol, acetone, and benzene. The solubility of this compound depends on the pH of the solution as well as the presence of glycine. H-beta-Ala-Gly-OH has an upfield shift when protonated, making it useful for analytical purposes. This compound can be used to prepare glycine methyl ester by reacting with methanol or hydrochloric acid.</p>

<p>Please enquire for more information about H-Leu-Gly-Arg-Ser-Gly-Gly-Asp-Ile-Ile-Lys-Lys-Met-Gln-Thr-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Potassium 4-methoxycinnamate is a fine chemical that is used as a versatile building block in the synthesis of complex compounds. It can be used in research and as a reagent or speciality chemical. It is also a useful building block for high quality, useful intermediate, and reaction component. Potassium 4-methoxycinnamate can be used as a scaffold to synthesize compounds with diverse applications such as pharmaceuticals, polymers, and agrochemicals.</p>

<p>Please enquire for more information about H-Arg-His-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Phenylpropionic acid is a reactive chemical that can be synthesized by an asymmetric process. It has been used in the synthesis of nonsteroidal anti-inflammatory drugs, as it inhibits the activity of cyclooxygenase and lipoxygenase enzymes. This chemical also binds to the hydroxyl group on target proteins, inhibiting their function. 2-Phenylpropionic acid is metabolized by microbial metabolism and can inhibit the activity of drug-metabolizing enzymes such as CYP3A4 and CYP2D6. It may also interact with other drugs that are processed by these enzymes, including warfarin and carbamazepine. 2-Phenylpropionic acid is a competitive inhibitor that binds to the active site of an enzyme and blocks its access to its substrate molecule. The binding of 2-phenylpropionic acid to enzyme's active site prevents the reactant from entering and reacting with the enzyme, thereby preventing a</p>

<p>Fmoc-Lys(N3)-OH is a glutamic acid molecule with a specific lysine and histidine residue. It has been shown to be cytotoxic in vitro, specifically targeting cancer cells. Fmoc-Lys(N3)-OH can be conjugated to vancomycin or other molecules that are not normally cell permeable for the treatment of neurodegenerative diseases. The divalent nature of this molecule allows it to cross the blood-brain barrier. Solid phase synthesis is used to produce this compound, which is then purified by chromatography and characterized by mass spectrometry.</p>

<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-alpha-Fmoc-N-delta-Boc-D-ornithine (NFDO) is an antibiotic that belongs to the group of macrocyclic, cyclic antibiotics. This drug has antibacterial activity against gram-negative pathogens and is most effective against E. coli. NFDO is synthesized by a solid phase synthesis that occurs in two stages: first, FMOC protected amino acids are coupled to the resin and then deprotection is carried out with piperidine in DMF at room temperature. The final product is obtained by cleavage of the peptide from the resin with trifluoroacetic acid and purification by HPLC.</p>

<p>ACTH is a polypeptide hormone that regulates the release of cortisol from the adrenal cortex. ACTH (18-39) is a fragment of ACTH which binds to the glucocorticoid receptor with high affinity. The carboxy terminal sequence of ACTH (18-39) is identical to that of human ACTH and can be used as an immunogen to produce monoclonal antibodies against ACTH. The monoclonal antibodies can then be used in prognostic studies for patients with congestive heart failure, diabetic neuropathy, or k562 cells. ACTH (18-39) has an optimum pH level of 7.0 and can bind to cellular receptors at physiological concentrations. It also has a molecular weight of 4,000 Daltons and is soluble in trifluoroacetic acid and hydrogen fluoride, but not in water or methanol.</p>

<p>Please enquire for more information about Cyclo(-Glu-Glu) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Asp-Tyr(PO3H2)-Val-Pro-Met-Leu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (p-Iodo-Phe7)-ACTH (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Methyl-L-trans-4-hydroxyproline hydrochloride is a bioactive compound that is present in the leaves of Semecarpifolia. It has been found to have antioxidant and anti-inflammatory properties. The chemical structure of N-methyl-L-trans-4-hydroxyproline hydrochloride is cyclic, butanamide, hexane, ethanolic extracts, and semecarpifolia. The family Meliaceae includes species such as Eucalyptus, which produces the bioactive compound cineole. Solvents used in this process are hexane and ethanolic extracts.</p>

<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>

<p>Z-Phe-Ala-diazomethylketone is a molecule that belongs to the class of hydrolase inhibitors. It has been shown to have inhibitory properties against trichomonas vaginalis and proteolytic activity against liver cells. Z-Phe-Ala-diazomethylketone also has a kinetic energy of 11.2 kcal/mol, which is higher than most protease inhibitors. This molecule has been shown to be effective as a cell vaccine in wild-type mice and as a protease inhibitor in brain cells. The optimal ph for this molecule is 7.5, which corresponds to its pKa value of 5.1.</p>

<p>Anti-Inflammatory Peptide 1 is a peptide that has been shown to have anti-inflammatory properties. It is synthesized from H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, with the hydroxyl group linked by an ester bond to the N terminal of the peptide. Antiinflammatory peptides can be used as potential biomarkers for inflammatory diseases or as a treatment for these diseases.</p>

<p>L-Glutamic acid 5-benzyl ester is an amino acid that has been synthesized to have a lysine residue. It is an ester hydrochloride and has been shown to have broad-spectrum antimicrobial properties. L-glutamic acid 5-benzyl ester's antimicrobial activity is thought to be due to its chemical structure which allows it to act as an antimicrobial peptide, binding to receptors on the surface of bacterial cells and inhibiting their growth. L-glutamic acid 5-benzyl ester also inhibits osteogenic genes in cervical cancer cells, but not in normal cells.</p>

<p>Please enquire for more information about (Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Lys-Met-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg(NO2)-OBzl p-tosylate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Met-Met-Met-OH is a synthetic, antifungal drug that inhibits the synthesis of fatty acids. It has been shown to inhibit the growth of E coli K-12, which is responsible for the production of toxic substances in the intestine. H-Met-Met-Met-OH inhibits peptidase activity and fatty acid synthesis by competing with other substrates for uptake into the cell. H-Met-Met-Met-OH also inhibits sugar transport, leading to a decrease in glycolysis and energy production. The drug has been used in clinical trials against Candida albicans and Cryptococcus neoformans.</p>

<p>Please enquire for more information about Z-Gly-Gly-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH is a nucleic acid sensor that can be used to detect the presence of specific nucleic acids (DNA or RNA) in a sample. Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH binds to nucleic acids, and then emits fluorescence when irradiated with light at a wavelength of 350 nm. Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH can be used as an assay for the detection of specific DNA sequences, such as those found in single nucleotide polymorphisms (SNPs).</p>

<p>Boc-Pro-Pro-Pro-Pro-OH is a synthetic peptide. It has been shown to have high specificity and is useful in the diagnosis of diseases that are caused by abnormal extracellular glutamic acid, hydroxyproline, or ion-exchange. Boc-Pro-Pro-Pro-Pro-OH has been used as a model for other peptides and has been shown to have acidic properties. The structure is dodecyl peptidic with a residue of -N(CH2)3-.</p>

<p>Hydrin 1 is a fatty acid that is expressed in the apical membrane of bladder cells, which are the cells that line the urinary tract. It is also found in the blood vessels and heart. Hydrin 1 has been shown to have biological properties such as being taken up by water, interacting with other molecules, and forming reaction products. The ventral part of the cell membrane is where Hydrin 1 is mostly expressed, but it can also be found in other parts of the organism. Hydrin 1 binds to messenger RNA and has been used as a model system for studying protein-lipid interactions. The effective dose for Hydrin 1 is not known. This drug can be conjugated with bile salts to form an active metabolite called hydroxylinoleic acid (HOLA). HOLA binds to receptors on vascular smooth muscle cells and lowers blood pressure by decreasing peripheral resistance and vascular tone.</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-46) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Hydroxy-5-methylpyridine (3HMP) is a chemical substance that has been classified as an amine. It is a product of the metabolism of purines, which are nitrogenous bases found in DNA and RNA. 3HMP is produced by aerogenic bacteria (such as Enterobacter), and can be used to estimate the number of these bacteria present in water samples. 3HMP has been shown to have antiviral properties against influenza virus, and can be used as a biomarker for the presence of other viruses in animals. 3HMP also has mineralization properties, which have been studied extensively, particularly with regards to pancreatic disease.</p>

<p>Please enquire for more information about (Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Val-Pro-Arg-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Phe-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Pro-4MbNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Cys-Thr-Cys-Cys-Ala-OH trifluoroacetate salt (KCTA) is a peptide that belongs to the group of thioneins and is characterized by a high content of lysine, cysteine and histidine residues. This peptide has been shown to be effective in treating subcutaneous tumors in mice. KCTA binds to metallothionein and gamma amino butyric acid (GABA), which are proteins that regulate energy metabolism in cells. KCTA has also been shown to have antimicrobial effects against human serum, which may be due to its ability to bind with thionein.</p>

<p>Acetate salt</p>

<p>Please enquire for more information about H-D-Lys-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The HIV-1 envelope protein, gp120, is a transmembrane glycoprotein that plays a key role in the viral entry process. The gp120 protein contains the binding site for the CD4 receptor and can be cleaved by proteases to remove the membrane-spanning domain. The resulting soluble gp120 (sgp120) is an important co-receptor for HIV infection of target cells such as prostate cancer cells. The sgp120 binds to heparin sulfate proteoglycans on the surface of target cells and triggers cellular activation pathways including angiogenic factors, which induce cell proliferation and migration. This process is important for tumour growth and metastasis, inflammatory bowel disease, and other inflammatory diseases. The sgp120 has also been shown to activate pro-apoptotic proteins such as Bcl-2 family members and Bax. These proteins play a crucial role in apoptosis pathway by regulating mitochondrial membrane integrity, cytochrome c release from mitochond</p>

<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine (Biotinylated BSA) is a categorized lipid that contains both carbohydrates and lipids. It is used to inseminate dairy cattle, but also has potential as a biomarker for fertility and metabolic diseases. Biotinylated BSA contains conjugates of fatty acids, which are important compounds in metabolism. The metabolome of biotinylated BSA includes nucleotides, carboxylic acids, and purines.</p>

<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>

<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that is used in the production of monoclonal antibodies. The enzyme was originally isolated from human pancreas, but has also been found in other sources including eggs, bovine pancreas, and various bacteria. Pyr-Phe-Leu-pNA hydrolyzes peptide bonds with a preference for serine and threonine residues. This enzyme has been shown to be effective at cleaving influenza virus protein hemagglutinin, which may be useful in the development of new vaccines. Pyr-Phe-Leu-pNA has also been shown to have high salt tolerance, making it a good candidate for use in food processing applications.</p>

<p>3-Cyano-2-methylphenylboronic acid is a high quality compound that can be used as a reagent, intermediate, or building block in the synthesis of complex compounds. This chemical is also useful as a speciality chemical and research chemical. 3-Cyano-2-methylphenylboronic acid has versatile uses in organic synthesis due to its versatility in reactions and building blocks.</p>

<p>H-Gly-Phe-bNA is a dinucleotide phosphate that is activated by phosphatase to form an active nucleotide. This nucleotide inhibits the polymerase chain reaction (PCR) by binding to the template DNA strand and preventing the addition of nucleotides by the DNA polymerase. The monoclonal antibody recognizes H-Gly-Phe-bNA and binds it in a radioactive assay, inhibiting the activity of this dinucleotide phosphate. Radiation causes H-Gly-Phe-bNA to produce reactive oxygen species, which can induce DNA damage or cause cell death. This nucleotide also has an acidic pH optimum for its activity, making it useful in acidic environments such as lysosomes. H-Gly-Phe-bNA also binds to cation channels and is localized primarily in the cytosol, with some found in mitochondria or microsomes. It also has a high affinity for calcium ions</p>

<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>H-Trp-Asn-OH is a synthetic amino acid with the chemical formula H-Trp-Asn-OH. It has been shown to act as a competitive antagonist of the 5HT3 receptor and can be used in the treatment of diseases such as irritable bowel syndrome, depression, and anxiety. The crystal structure of H-Trp-Asn-OH shows that it is an L type polymerase that contains a carboxy group. The docking studies show that this compound binds to the receptor proteins of the subunits and inhibits fission by triphosphatases, which are enzymes involved in cellular processes such as transcription and protein synthesis.</p>

<p>Please enquire for more information about (Tyr38,Phe42·46)-Osteocalcin (38-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-b-Ala-Phe-Pro-OH is a chemical compound that is used as a reaction component, reagent, and useful scaffold. It reacts with various other chemicals to form complex compounds. This synthetic compound can be used as an intermediate in the synthesis of peptides, proteins, and other organic compounds. Fmoc-b-Ala-Phe-Pro-OH can also be used as a building block for the synthesis of speciality chemicals.</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Ala-Pro-Nva-4-chloro-SBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Val-Leu-Ser-Glu-Gly-OH is a polypeptide that is hydrophobic and has carboxypeptidase activity. It hydrolyzes anions, such as the penicillin G, which has been shown to have a high affinity for this enzyme. H-Val-Leu-Ser-Glu-Gly-OH has also been shown to interact with other proteins through hydrophobic interactions. When used in high concentrations, it can be used to filter out substances that are hydrophobic. It can also be used to hydrolyze anions and divalent ions, such as copper and zinc.</p>

<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Val-Leu-OH·HCl is a hydrolytic cleavage product of the covalent adduct of valproic acid and HCl. It is an acidic compound that can be produced by hydrolysis or by exposure to alcohols. This compound is also known as ethylene glycol monobutyl ether, which is formed when ethylene reacts with butanol. H-Val-Leu-OH·HCl has been shown to cause termination in animal experiments and has been detected in humans following alcohol exposure. It also has some toxic effects on animals such as liver damage, kidney damage, and death.</p>

<p>Please enquire for more information about (Ala6,D-Trp8,L-alaninol15)-Galanin (1-15) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin (1-16) (mouse, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide is a pharmacological agent that inhibits the toll-like receptor 4 signaling pathway. L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide has been shown to cause caspase independent cell death by inducing cathepsin and iron homeostasis. The drug also causes polymerase chain reaction inhibition and neuronal death in vivo.</p>