Acides aminés (AA)

<p>Please enquire for more information about 4-Chloro-2-iodo-phenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Arg-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.

<p>Acetate salt</p>

<p>1-Methyl-1H-imidazole-5-carboxylic acid is an amide that is used as a hardener in medicines. It can be synthesized by the reaction of ethyl formate with thionyl chloride and imidazoles. The yield of this product is high, and it can be produced in different stereoisomeric forms. 1-Methyl-1H-imidazole-5-carboxylic acid is used to produce other medicines, such as painkillers, tranquilizers, diuretics, and antibiotics. This product has been shown to have a number of health benefits, including reducing cholesterol levels and blood pressure.</p>

<p>Please enquire for more information about Fmoc-Lys(Boc)-Thr(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Coagulation Factor XIIIa (190-230) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Tyr(tBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(Acm)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Phe-Val-OH is an optical isomer of the molecule Z-Val-OH. It can be synthesized from the reactants Isobutyl, Chloroformate, and Hydrophobic. This synthetic product has been shown to have high yields and specificities. The chiral center in this molecule causes it to rotate light in one direction or another, which means that it can be used to create a spectrum of colors. The synthesis of this molecule takes place in a kinetically controlled manner. When mixed with amines, carboxylic acids, and tripeptides, this compound will form a tripeptide bond with two amino acids on either side of the peptide chain.</p>

<p>Please enquire for more information about Myristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-Fluoro-3-phenylpropan-2-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Leu-psi(CH2NH)Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GM-CSF (96-112) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-2-Methyl-5-(prop-1-en-2-yl)cyclohex-2-enone is an organic compound that has been shown to induce apoptosis in prostate cancer cells. The mechanism of this induction is not yet fully understood, but it may be due to the inhibition of the synthesis of proteins required for cell division. It also had a significant effect on locomotor activity in mice. This compound has been shown to have acute toxicities, and its phase transition temperature is below room temperature. It can be used as a fumigant and an inorganic acid, and it has been proposed as a potential fluorescence probe for natural compounds.</p>

Please enquire for more information about Boc-Asp(OcHex)-Merrifield resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Please enquire for more information about Myelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Pro-Pro-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Gly-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about L-allo-Threoninol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-N-Me-D-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Vasopressin is a peptide hormone that regulates water balance. It is synthesized in the hypothalamus and stored in the posterior pituitary gland, from where it is released when blood pressure falls. Vasopressin binds to V1 receptors in the kidney and vascular smooth muscle cells, causing vasoconstriction and increased blood pressure. Vasopressin also stimulates phosphatidic acid synthesis and hypotension, which are mediated through V2 receptors. Vasopressin has been found to be effective against cardiac arrest and myocardial infarction in animals. This drug has also been shown to stimulate the paraventricular nucleus of the hypothalamus and inhibit sympathetic activity in ganglia.</p>

<p>Decanoyl-Arg-Val-Arg-Lys-chloromethylketone is a potent activin antagonist that has been shown to inhibit follicle development in ovary cells. It also blocks the protease activity of leishmania, which is a parasite that causes cutaneous leishmaniasis. This drug binds to proteases and inhibits their activity by competing with substrates for the active site. Decanoyl-Arg-Val-Arg-Lys-chloromethylketone is not expressed in the submandibular gland or the submaxillary gland, which are salivary glands.</p>

<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FA-Phe-Lys-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Isovaleryl-Val-Val-Sta-OEt is a peptide hormone and active inhibitor of the enzyme pepsin. This drug has been shown to have proteolytic activity in vitro, with a pepsin rate constant of 0.0015 min−1. It also inhibits the protease activity of trypsin, chymotrypsin, and elastase at a similar rate. Isovaleryl-Val-Val-Sta-OEt has been shown to be an active inhibitor of polymerase chain reaction (PCR) and reverse transcriptase activities. This drug is not absorbed through skin and can be used as a nonimmunogenic reagent for biochemical studies on water permeability and signal peptide sequences in biological samples.</p>

<p>H-Asp-Asn-Gln-OH is a basic amino acid that is cleaved by endopeptidase to form H-Asp, H-Asn, and H-Gln. It is also cleaved by serine proteases to form the amino acid residues of arginyl, aspartyl, and glutamyl. The residue sequence can be determined through hplc analyses of microsomal proteins. This amino acid has been shown to have a regulatory effect on the metabolism of other amino acids in rat liver cells. Asparaginyl and glutamyl are essential for the synthesis of proproteins.</p>

<p>Fmoc-4-Cpa-4-Cpa-OH is a versatile building block that can be used to synthesize complex compounds with interesting biological activity. It is a reagent, speciality chemical, and useful scaffold for research chemicals. Fmoc-4-Cpa-4-Cpa-OH has been used in the synthesis of a number of biologically active compounds and as an intermediate for the synthesis of other chemical compounds.</p>

<p>H-Thr-Arg-OH sulfate salt is a molecule that contains the active amino acid residues of vasoactive intestinal peptide (VIP) and reversed-phase high-performance liquid chromatography. The structure of VIP was determined by stepwise synthesis and chloromethyl ketone activation. It has been shown to have an intestinal effect, which is due to its ability to increase blood pressure. This drug also has potential as a therapeutic agent in the treatment of hypertension, heart disease, or diabetes mellitus.</p>

<p>(2R,3S)-3-Amino-2-hydroxy-3-phenylpropanoic acid hydrochloride is an organic compound that is used in the manufacture of taxol, an anticancer drug. It is synthesized by reacting chloroacetic acid with a metal hydroxide, such as sodium hydroxide or potassium hydroxide. The reaction proceeds spontaneously to form the enantiomerically pure (2R,3S) form and unreacted (2S,3R) form. The (2R,3S) enantiomer has been found to be more reactive than the (2S,3R) form. Quaternary ammonium salts are formed when the (2R,3S) enantiomer reacts with quaternary ammonium compounds such as benzyltrimethylammonium chloride. This compound can also be used in catalytic reactions to produce drugs such as carbapenems and pen</p>

<p>Please enquire for more information about (D-Ala2)-Dynorphin A (1-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala-Arg-Gly-Ala-Ile-Phe-Gln-Ala-NH2 is a growth factor that has been shown to have antiinflammatory and immunosuppressive effects in autoimmune diseases. It also has the ability to bind to peptides, proteins, and particle surfaces. This peptide has been shown to be effective against cancer cells by inhibiting tumor growth and increasing the effectiveness of radiation therapy. Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala Arg Gly Ala Ile Phe Gln Ala NH2 is also an immunosuppressant that can reduce inflammation caused by infectious diseases such as HIV/AIDS.</p>

<p>Please enquire for more information about Z-Lys-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Asp28)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Met-Ser-OH is a dihedral molecule that has an amino acid composition of H, Met, Ser, and OH. It is acidic and has efficiencies in polarizability and acceptor. The dipole moment of the molecule is hydrogen bonding interactions with sequences. The vibrational frequencies are computationally predicted by computational methods. The sulfate fractionation was used to determine the percent of H-Met-Ser-OH in human liver tissue.</p>

<p>Fmoc-4-(Boc-amino)-L-phenylalanine is a useful building block, which is used in the synthesis of complex compounds and research chemicals. It is also a reaction component in the synthesis of compounds. Fmoc-4-(Boc-amino)-L-phenylalanine has CAS No. 174132-31-1 and can be used as a versatile building block to produce high quality reagents.</p>

<p>(S)-9,10-Difluoro-2,3-dihydro-3-methyl-7-oxo-7H-pyrido[1,2,3-de]-1,4-benzoxazine-6-carboxylic acid ethyl ester is an acidic substance that can be produced by the amination of piperazine with chloroacetic acid. The reaction solution is heated to a temperature of about 120°C for about 30 minutes and then cooled to room temperature. The product precipitates as a white solid. This compound has been shown to have antibacterial activity against methicillin resistant Staphylococcus aureus (MRSA) in plates.</p>

<p>N-(4-Methoxybenzylidene)-4-butylaniline is an organic compound that belongs to the group of liquid crystals. It has been used in the study of phase transitions and thermal properties. The melting point of N-(4-methoxybenzylidene)-4-butylaniline is between -80 and -90 °C, depending on the solvent. This compound has a low proton affinity, but it can be oxidized to form a radical cation.</p>

<p>Please enquire for more information about ACTH (34-39) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Farnesyl-Met-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Anti-Inflammatory Peptide 1 is a peptide that has been shown to have anti-inflammatory properties. It is synthesized from H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, with the hydroxyl group linked by an ester bond to the N terminal of the peptide. Antiinflammatory peptides can be used as potential biomarkers for inflammatory diseases or as a treatment for these diseases.</p>

<p>Please enquire for more information about Z-D-Ala-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>