Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30479 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ghrelin-[Cys(AF647)] Human
<p>Ghrelin is a peptide hormone mainly produced in the stomach. Ghrelin is involved in several physiological processes, including feeding, lipid accumulation, stress response- anxiety- cardiac performance- immunity and inflammation, taste sensation, reward-seeking behaviour, glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin exerts its actions by binding the growth hormone secretagogue receptor (GHSR), mainly found in the hypothalamic and mesolimbic brain regions and peripheral organs (adipose tissue, adrenals, and stomach).Ghrelin is produced by the cleavage of the precursor peptide preproghrelin. The attachment of a fatty acid to its serine 3 residue makes a form capable of activating GHSR.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.This ghrelin has a C-terminal AF647, a structural analog to Alexa Fluor 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides.</p>Degré de pureté :Min. 95%Masse moléculaire :4,326.9 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C57H72N14O8Degré de pureté :Min. 95%Masse moléculaire :1,081.27 g/molInterleukin II (60-70)
<p>Catalogue peptide; min. 95% purity</p>Formule :C68H104N14O14SMasse moléculaire :1,373.74 g/molDoc-6 (130-145)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H134N26O26SMasse moléculaire :1,980.25 g/molSuccinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21)
CAS :<p>Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.</p>Formule :C86H117N17O27Degré de pureté :Min. 95%Masse moléculaire :1,820.95 g/molδ1-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H97N21O14SMasse moléculaire :1,512.8 g/molDynorphin A amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H156N32O22Masse moléculaire :2,146.55 g/molPACAP(1-38)-Lys(Biotin), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C219H357N67O56S2Masse moléculaire :4,888.83 g/molFmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH
CAS :<p>Please enquire for more information about Fmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C34H38N2O7Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :586.67 g/molEndotrophin (mouse) trifluoroacetate salt
CAS :<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>Formule :C345H520N92O106S7Degré de pureté :Min. 95%Masse moléculaire :7,876.84 g/molBradykinin-Like Neuropeptide (3-11) (Aplysia californica)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H77N21O12Masse moléculaire :1,068.22 g/molBig Endothelin-1 (22-39), rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H135N25O27Masse moléculaire :5,511 g/molN-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam
CAS :<p>Please enquire for more information about N-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C54H71N15O9Degré de pureté :Min. 95%Masse moléculaire :1,074.24 g/mol[Val35] -β-Amyloid (1-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C203H311N55O60Masse moléculaire :4,481.96 g/molBiotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :1,745.99 g/mol[Lys0]-γ-1-MSH (41-58), amide
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :1,641.1 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H97N21O16S1Masse moléculaire :1,424.66 g/molSKIGKV-NH2
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H55N9O7Masse moléculaire :629.81 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H125N23O28SMasse moléculaire :1,877.08 g/molAmyloid β-Protein (35-25) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C45H81N13O14SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,060.27 g/molH-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH
CAS :<p>H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a proteolytic inhibitor that inhibits the aspartic and hydrolytic enzymes. It has been shown to inhibit the activity of trypsin, pepsin, and elastase in human serum. This inhibitor also inactivates fibronectin by proteolysis. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu OH has been shown to be specific for acidic proteases such as pepsin. The natural inhibitors of this peptide are Pro, Thr, Glu, Phe, Arg and Leu.</p>Formule :C44H63N11O13Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :954.04 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molFmoc-Lys(Nde)-OH
CAS :<p>Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C32H29N3O8Degré de pureté :Min. 95%Masse moléculaire :583.59 g/molCC Chemokine Receptor 3 Fragment I, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C142H223N35O53S2Masse moléculaire :3,332.68 g/molH-Ile-Ile-Ile-OH acetate salt
CAS :<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C18H35N3O4Degré de pureté :Min. 95%Masse moléculaire :357.49 g/molβ-Interleukin I (163-171), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H64N12O19Masse moléculaire :1,005.01 g/molDynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H103N21O13Masse moléculaire :1,362.66 g/molZ-Gly-Val-OH
CAS :<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>Formule :C15H20N2O5Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :308.33 g/molH-Trp-Trp-OH
CAS :<p>H-Trp-Trp-OH is a reaction product of the amino acid tryptophan and various electron donors. The radical form of H-Trp-Trp-OH has been studied using 2D nuclear magnetic resonance (NMR) spectroscopy to determine its structure. In addition, H-Trp-Trp-OH has been used to study the mechanism of protein phosphorylation reactions. This chemical can be prepared from a solution of tryptophan in water and an oxidizing agent such as hydrogen peroxide or sodium hypochlorite. The frequency shift observed for H-Trp-Trp-OH was attributed to the presence of a constant that was found to be 10 Hz/M, indicating that this substance is a radical form. The sample preparation technique used in this experiment consisted of adding an equal volume of acetic acid to an unknown sample and then centrifuging it at 5000 rpm for five minutes before measuring its fluorescence emission.</p>Formule :C22H22N4O3Degré de pureté :Min. 95%Masse moléculaire :390.44 g/molβ-Defensin-3, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/mol[D-Ala2] Deltorphin II
<p>Catalogue peptide; min. 95% purity</p>Formule :C38H54N8O10Masse moléculaire :782.90 g/molβ-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formule :C145H209N41O46Masse moléculaire :3,262.53 g/molβ-Amyloid (30-16)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H126N24O21S2Masse moléculaire :1,896.22 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C219H365N73O66SMasse moléculaire :5,108.86 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H108N22O16Masse moléculaire :1,453.72 g/molLL-37, Antimicrobial Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C205H340N60O53Masse moléculaire :4,493.37 g/molC. difficile Toxin B (529-536)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H71N13O15Masse moléculaire :1,070.18 g/molβ II probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C94H150N26O31SMasse moléculaire :2,172.46 g/molSer-Ala-SAP-IIB
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H71N13O14S2Masse moléculaire :1,046.24 g/mol[Tyr27]-pTH (27-48) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C104H159N29O31Masse moléculaire :2,311.60 g/mol[Glu3,4,7,10,14]-Conantokin G
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H137N25O35Masse moléculaire :2,045.16 g/molMMP-8 Substrate, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H63N13O13Masse moléculaire :1,042.14 g/molHIV-1, HIV-2 Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H80N12O14Masse moléculaire :1,145.3 g/molβ-Casomorphin (1-3) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C23H28N4O4Masse moléculaire :424.50 g/mol[D-Trp2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H43N7O6SMasse moléculaire :701.85 g/molC-Type Natriuretic Peptide (1-53) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C251H417N81O71S3Masse moléculaire :5,801.81 g/mol[Des-Asp10]Decorsin, Leech
<p>Catalogue peptide; min. 95% purity</p>Formule :C175H272N54O59S6Masse moléculaire :4,268.78 g/molPhosphorylase Kinase b-Subunit Fragment (420-436)
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H130N31O25SMasse moléculaire :1,946.13 g/molIL-8 (-5 to +5)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H86N14O14Masse moléculaire :1,083.31 g/molNps-Val-OH·DCHA
CAS :Produit contrôlé<p>Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C11H14N2O4S·C12H23NDegré de pureté :Min. 95%Masse moléculaire :451.62 g/mol2B/3, Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H58N14O12Masse moléculaire :949.09 g/molNES Topoisomerase II α (1017-1028)
<p>Catalogue peptide; min. 95% purity</p>Formule :C73H117N19O19Masse moléculaire :1,564.86 g/molBak-BH3
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H125N25O24Masse moléculaire :1,724.95 g/molβ-Casomorphin (1-4) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H34N4O6Masse moléculaire :522.61 g/molBiotin-Exendin 4
<p>Catalogue peptide; min. 95% purity</p>Formule :C194H296N52O62S2Masse moléculaire :4,412.96 g/molLMP1,TDD
<p>Catalogue peptide; min. 95% purity</p>Formule :C68H102N26O35Masse moléculaire :1,843.72 g/mol[Ac-Cys4,DPhe7,Cys10] a-MSH (4-13), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H88N18O13S2Masse moléculaire :1,345.61 g/molBiotin-Dynorphin A (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C109H169N33O25SMasse moléculaire :2,373.83 g/mol[Trp7,β-Ala8]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H57N9O10SMasse moléculaire :868.03 g/molHepatitis Virus C NS3 Protease Inhibitor 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C29H45N6O16S2Masse moléculaire :796.8 g/molBiotin-Bombesin
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H126N26O21S2Masse moléculaire :1,864.2 g/molAc-ACTH (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C97H147N29O24SMasse moléculaire :2,135.50 g/molLeptin Receptor Precursor
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H94N13O19PMasse moléculaire :1,332.49 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/mol[D-Ala2,DMet5] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H37N5O7SMasse moléculaire :587.70 g/molAmyloid β-Protein (1-42) hydrochloride salt
CAS :<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease; Hydrochloride salt</p>Formule :C203H311N55O60SDegré de pureté :Min. 95%Masse moléculaire :4,514.04 g/molTNF-α (72-82), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H86N18O16Masse moléculaire :1,171.33 g/molCathepsin G (77-83)
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H59N15O12Masse moléculaire :942.01 g/molWRW4
CAS :<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C61H65N15O6Degré de pureté :Min. 95%Masse moléculaire :1,104.27 g/molPrepro TRH (53-74)
<p>Catalogue peptide; min. 95% purity</p>Formule :C118H182N32O32Masse moléculaire :2,560.96 g/molH-Ile-Trp-OH
CAS :<p>H-Ile-Trp-OH is an acetylcholine esterase inhibitor that has been shown to have potent inhibitory activity against lorazepam. It binds to the active site of the enzyme, preventing it from breaking down acetylcholine and other neurotransmitters in the brain. H-Ile-Trp-OH is also a potent inhibitor of stenotrophomonas maltophilia, which is a bacterium found in chronic bronchitis patients. The drug has been tested in clinical studies for use as an immunomodulatory agent but has not yet been approved for this purpose.</p>Formule :C17H23N3O3Degré de pureté :Min. 95%Masse moléculaire :317.38 g/mol2B-(A)
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H137N28O28SMasse moléculaire :1,983.23 g/molFmoc-Mating Factor a TFA salt
CAS :<p>Please enquire for more information about Fmoc-Mating Factor a TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C97H124N20O19S(freebase)Degré de pureté :Min. 95%Masse moléculaire :1,906.21 g/molZ-D-Arg(Z)2-OH
CAS :<p>Please enquire for more information about Z-D-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C30H32N4O8Degré de pureté :Min. 95%Masse moléculaire :576.6 g/molSuc-Leu-Leu-Val-Tyr-pNA
CAS :<p>Please enquire for more information about Suc-Leu-Leu-Val-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C36H50N6O10Degré de pureté :Min. 95%Masse moléculaire :726.82 g/molFmoc-Glu(OtBu)-Thr(psi(Me,Me)pro)-OH
CAS :<p>Fmoc-glu(otbu)-thr(psi(Me,Me)pro)-OH is a c1-6 alkoxy, expressed, alkenyl, linker, c1-6 alkyl, efficiency, sequence that can be used for peptide synthesis. It is an efficient linker for the synthesis of peptides and has been shown to yield high yields with few side products. The hydroxyl group on the side chain of the amino acid residue provides an additional site for acylation. This product also contains an aralkyl and alkoxy group that can be used in further reactions.</p>Formule :C31H38N2O8Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :566.64 g/molCorticotropin trifluoroacetate
<p>Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Boc-Thr(Ala-Fmoc)-OH
CAS :<p>Please enquire for more information about Boc-Thr(Ala-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C27H32N2O8Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :512.55 g/molZ-Asu (OtBu)-OH·DCHA
CAS :Produit contrôlé<p>Please enquire for more information about Z-Asu (OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C20H29NO6·C12H23NDegré de pureté :Min. 95%Masse moléculaire :560.77 g/mol[β-Ala8]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H56N8O10SMasse moléculaire :781 g/molPep 4AK
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H153N27O19Masse moléculaire :1,809.29 g/molH-Ile-Arg-Pro-OH
CAS :<p>Please enquire for more information about H-Ile-Arg-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C17H32N6O4Degré de pureté :Min. 95%Masse moléculaire :384.47 g/molAdrenomedullin (1-12), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H100N22O19SMasse moléculaire :1,513.7 g/molMSP-1 (20-39), Merozoite Surface Peptide 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C102H165N25O35Masse moléculaire :2,301.60 g/molH-D-Asp(OtBu)-allyl ester·HCl
CAS :<p>Please enquire for more information about H-D-Asp(OtBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C11H19NO4·HClDegré de pureté :Min. 95%Masse moléculaire :265.73 g/molKGF Receptor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C114H174N30O42SMasse moléculaire :2,668.90 g/molZ-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone is an apoptosis inducer that belongs to the category of small molecules. It has been shown to induce apoptosis in cells by binding to DNA and inhibiting transcription, leading to DNA fragmentation and the activation of caspase-8. Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone has also been shown to have a synergistic effect on cells when combined with other potent inducers of apoptosis. This drug binds to toll receptors (TLR) and IL2 receptors, which are important for cell signaling pathways.</p>Formule :C30H43FN4O11Degré de pureté :Min. 95%Masse moléculaire :654.68 g/molZ-Gly-Gly-Trp-OH TFA
CAS :<p>Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C23H24N4O6•C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :566.48 g/molRcramp
<p>Catalogue peptide; min. 95% purity</p>Formule :C181H302N50O48Masse moléculaire :3,946.73 g/molGastrin Releasing Peptide (1-16), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H121N17O20SMasse moléculaire :1,600.9 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C197H317N59O54S3Masse moléculaire :4,472.26 g/molEGF Receptor Substrate 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H100N15O26PMasse moléculaire :1,622.68 g/molAntioxidant peptide B
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H91N17O15Masse moléculaire :1,254.47 g/molβ-Amyloid/A4 Protein Precursor (APP) (96-110), analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H128N32O19S2Masse moléculaire :1,918.25 g/mol[D-Pro2]-β-Casomorphin (1-5) , bovine, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H38N6O6Masse moléculaire :578.7 g/molEndothelin-1 (1-15), amide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H109N17O23S5Masse moléculaire :1,717.04 g/molLeptin (138-167) (human)
CAS :<p>Please enquire for more information about Leptin (138-167) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C141H224N37O47S2Degré de pureté :Min. 95%Masse moléculaire :3,253.64 g/molWWamide-3
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H66N12O9SMasse moléculaire :963.18 g/molSH2 Domain Ligand (3)
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H122N15O27PSMasse moléculaire :1,813.03 g/mol[D-Ala2, DArg6] Dynorphin A, (1-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H128N24O15Masse moléculaire :1,618.02 g/molAc-VQVD-pNA
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H56N6O13Masse moléculaire :997.08 g/mol[D-Tyr6, β-Ala11, β-Phe13, Nle14]-Bombesin
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H115N23O18Masse moléculaire :1,698.98 g/molPLM derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H96N24O12Masse moléculaire :1,213.47 g/molFas C-Terminal Tripeptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C16H29N3O6Masse moléculaire :359.43 g/molp3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H97N17O19Masse moléculaire :1,348.53 g/molR-G-D-S-P-A-S-S-K-P
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H68N14O16Masse moléculaire :1,001.07 g/molAmyloid Bri Protein (1-34)
<p>Catalogue peptide; min. 95% purity</p>Formule :C173H273N49O52S2Masse moléculaire :3,935.55 g/mol[D-Trp8,D-Cys14]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H104N18O19S2Masse moléculaire :1,637.91 g/molAtrial Natriuretic Factor (4-28) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H175N39O35S3Masse moléculaire :2,724.02 g/molSelectin
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H105N16O18S2Masse moléculaire :1,426.75 g/molCecropin A (1-7)-Melittin A (2-9) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C89H152N22O15Masse moléculaire :1,770.34 g/molBiotin-Angiotensin I, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H103N19O16SMasse moléculaire :1,522.81 g/molAmyloid β-Protein (25-35) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H82N14O13SMasse moléculaire :1,059.31 g/molMKKp2
<p>Catalogue peptide; min. 95% purity</p>Formule :C85H158N31O26S1Masse moléculaire :2,062.41 g/molα-Conotoxin MI
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H92N22O17S4Masse moléculaire :1,497.74 g/molβ-Endorphin (1-26), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C130H208N32O38SMasse moléculaire :2,859.36 g/molRSK Substrate, S6 (231-239)
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H88N22O11Masse moléculaire :1,113.34 g/mol[D-Ala2]-β-Casomorphin (1-4) amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C26H33N5O5Masse moléculaire :495.58 g/molCDPKS, Syntide analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H86N16O13Masse moléculaire :1,083.31 g/molHypercalcemia Malignancy Factor (1-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C180H287N57O48Masse moléculaire :4,017.55 g/molBiotin-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H118N20O21S3Masse moléculaire :1,864.21 g/molHelodormin
<p>Catalogue peptide; min. 95% purity</p>Formule :C176H285N47O49Masse moléculaire :3,843.47 g/molCaspase 2 Substrate 1m (ICH-1), fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H44N6O12Masse moléculaire :716.8 g/molBiotin-LC-Protein Kinase G Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C69H121N25O18SMasse moléculaire :1,621 g/molH-D-Ile-OBzl·p-tosylate
CAS :<p>H-D-Ile-OBzl·p-tosylate is a synthetic compound that has been found to have an excitatory effect on the bitter taste receptor. The leaves of plants are mutant and agglutination tests for this compound show that it is a hexapeptide. H-D-Ile-OBzl·p-tosylate can be synthesized from erythritol and p-toluenesulfonyl chloride. The chemical data for this compound indicates that it has a molecular weight of 442.3 Da and the observed spectra indicate that it is a white solid with no charge.</p>Formule :C13H19NO2·C7H8O3SDegré de pureté :Min. 95%Masse moléculaire :393.5 g/molAc-a-CGRP (19-37) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C88H139N25O26Masse moléculaire :1,963.24 g/molPreprogalanin 28-67, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C198H312N62O58Masse moléculaire :4,488.96 g/molβ-Amyloid (13-27)
<p>Catalogue peptide; min. 95% purity</p>Formule :C84H126N24O24Masse moléculaire :1,856.09 g/molBiotin-Obestatin (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C126H190N34O35Masse moléculaire :2,773.19 g/molγ-2-MSH (41-58), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H100N22O15SMasse moléculaire :1,569.82 g/molLHRH, salmon
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H73N15O13Masse moléculaire :1,212.36 g/molch-Relaxing Peptide (CARP)
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H67N11O7S2Masse moléculaire :830.13 g/molProtein Kinase C Substrate, Glycogen Synthase (1-8)
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H104N18O15Masse moléculaire :1,269.6 g/molCalcitonin C-terminal Adjacent Peptide, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H117N23O27SMasse moléculaire :1,889.05 g/molInfluenza HA (210-219)
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H74N10O17Masse moléculaire :1,027.15 g/molγ-MSH (3-8)
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H52N12O7SMasse moléculaire :832.98 g/molBiotin-[Gln1]-Gastrin I (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C107H140N22O34S2Masse moléculaire :2,342.51 g/molDynorphin A (3-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H114N22O12Masse moléculaire :1,383.76 g/molAmyloid Dan Protein (1-34)
<p>Catalogue peptide; min. 95% purity</p>Formule :C185H268N48O51S2Masse moléculaire :4,044.63 g/molBoc-Leu-Gly-Arg-pNA
CAS :<p>a chromogenic substrate for horseshoe crab clotting enzyme, which is used in quantitative assays of endotoxin.</p>Formule :C25H40N8O7Couleur et forme :PowderMasse moléculaire :564.63 g/molMBP (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H135N27O26Masse moléculaire :1,879.12 g/mol(p-Iodo-Phe7)-ACTH (4-10)
CAS :<p>Please enquire for more information about (p-Iodo-Phe7)-ACTH (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C44H58IN13O10SDegré de pureté :Min. 95%Masse moléculaire :1,087.98 g/molKinase Domain of Insulin Receptor (5)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H110N19O33Masse moléculaire :1,862.77 g/molCathelicidin LL 37
CAS :<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>Formule :C205H340N60O53Degré de pureté :Min. 95%Masse moléculaire :4,493.27 g/molBiotin-Insulin Receptor (1142-1153), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H122N22O25SMasse moléculaire :1,848.08 g/molPRRS-RSAB-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H61N11O18Masse moléculaire :1,020.03 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS :<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C44H66N12O12Degré de pureté :Min. 95%Masse moléculaire :955.07 g/molGLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat)
CAS :<p>Catalogue peptide; min. 95% purity</p>Formule :C140H214N36O43Masse moléculaire :3,089.48 g/molβ-Amyloid (22-35)
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H102N16O21SMasse moléculaire :1,403.63 g/molAc-Adhesin (1025-1044) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C97H160N26O32Masse moléculaire :2,202.51 g/molGRF (1-29) amide (human) acetate salt
CAS :<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formule :C149H246N44O42SDegré de pureté :Min. 95%Masse moléculaire :3,357.88 g/molα-Neo-Endorphin Analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H102N20O13Masse moléculaire :1,383.68 g/mol[D-Asp1]-Amyloid-β-Protein (1-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C203H311N55O60SMasse moléculaire :4,514.14 g/mol[Tyr1]-Adipokinetic Hormone, locust
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H78N14O15Masse moléculaire :1,211.5 g/molAc-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt
CAS :<p>Please enquire for more information about Ac-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C33H51N9O8•C2HF3O2Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :815.83 g/molH-GTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGA VLVQREKDLPNYNWNSFGLRF-NH2
<p>Kisspeptin P</p>Formule :C257H393N75O78Degré de pureté :Min. 95%PKA Regulatory Subunit II Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C92H151N28O32PMasse moléculaire :2,192.39 g/molN-α-Benzoyl-L-argininamide
CAS :<p>N-alpha-Benzoyl-L-argininamide is a synthetic compound that is used as an enzyme inhibitor. It binds to the active site of proteases, thereby inhibiting their activity. This drug has been shown to inhibit the activities of phosphodiesterase and phosphatase enzymes in vitro. N-alpha-Benzoyl-L-argininamide also inhibits the proteolytic degradation of hippuric acid and casein in vitro. The binding affinity for this drug is due to its structural similarity with substrates such as glutamate and rhizosphere exudates.</p>Formule :C13H19N5O2Degré de pureté :Min 98%Couleur et forme :White PowderMasse moléculaire :277.32 g/molAGRP (87-132), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C219H339N65O63S11Masse moléculaire :5,243.17 g/molA-A-A-Y-G-G-F-L
<p>Catalogue peptide; min. 95% purity</p>Formule :C37H52N8O10Masse moléculaire :768.87 g/molHypertrehalosaemic Neuropeptide, Nauphoeta cinerea
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H67N13O14Masse moléculaire :1,074.19 g/molLKRApYLG-NH2
<p>Catalogue peptide; min. 95% purity</p>Formule :C38H67N12O11PMasse moléculaire :899.03 g/molCarassin (Carrassius Auratus)
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H175N35O27SMasse moléculaire :2,367.83 g/molω-Conotoxin MVIIC
CAS :Produit contrôlé<p>Omega-Conotoxin MVIIC is a peptide toxin that blocks the voltage-dependent calcium channels. It has been shown to have neuroprotective properties and to inhibit glutamate induced neurotoxicity in vitro and in vivo. Omega-Conotoxin MVIIC inhibits neurotransmitter release by blocking the calcium channels and thereby reduces oxidative stress, which prevents neuronal cell death. This toxin also blocks the activity of voltage-dependent sodium channels, but its effects are not as potent as those on calcium channels. Omega-Conotoxin MVIIC has been found to be effective against cerebellar granule neurons, as well as other neurons in the brainstem, cerebellum, hippocampus, and cerebral cortex. The molecular weight of this toxin is approximately 10 kDa and it contains subunits (a total of eight).</p>Formule :C106H178N40O32S7Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,749.26 g/molN-Hippuryl-His-Leu trifluroacetate hydrate
CAS :<p>Hippuryl-His-Leu trifluroacetate hydrate can be used as an artificial substrate for angiotensin-converting enzyme (ACE).</p>Formule :C21H27N5O5(C2F3O2)x(H2O)xDegré de pureté :Min. 95%Masse moléculaire :429.47 g/molDynorphin A (2-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H117N23O13Masse moléculaire :1,440.81 g/molLocustachykinin I
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H63N13O11Masse moléculaire :938 g/molβ-Amyloid (1-49)
<p>Catalogue peptide; min. 95% purity</p>Formule :C239H376N62O69SMasse moléculaire :5,253.97 g/molInsulin Receptor (1142-1153)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H107N19O24Masse moléculaire :1,622.77 g/molBiotin-MBP Derivatized Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C105H166N28O25Masse moléculaire :2,252.73 g/molAngiotensin II Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H72N13O15PMasse moléculaire :1,126.20 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS :<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C159H267N49O43Degré de pureté :Min. 95%Masse moléculaire :3,553.13 g/molFmoc-Gly-Cys(Psi(Dmp,H)pro)-OH
CAS :<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C29H28N2O7SDegré de pureté :Min. 95%Masse moléculaire :548.61 g/molBAD (103-127), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C137H212N42O39SMasse moléculaire :3,103.54 g/molDABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt
CAS :<p>DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt is a fluorescent substrate for the SARS coronavirus. This compound is an inhibitor of the enzyme that is the target of a drug candidate that inhibits the replication of this virus. Molecular docking studies have shown that DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt binds to 3clpro, which is part of the active site of the enzyme’s catalytic pocket. Inhibition activity was seen in experiments using recombinant proteins, and kinetic analysis showed this inhibitor has a Ki value of 0.7 mM.</p>Formule :C95H141N25O24S2·C2HF3O2Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :2,195.47 g/molβ-Endorphin (1-27), camel, bovine, ovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C136H215N35O39SMasse moléculaire :2,996.51 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS :<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>Formule :C32H49N5O7•C2H4O2Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :675.81 g/molBTK derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H115N17O18S2Masse moléculaire :1,570.95 g/molMca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS :<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C49H68N14O15Degré de pureté :Min. 95%Masse moléculaire :1,093.15 g/molC. difficile Toxin B (232-241)
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H74N16O18Masse moléculaire :1,103.17 g/molBiotin-(Leu8,D-Trp22,Tyr25)-Somatostatin-28
<p>Catalogue peptide; min. 95% purity</p>Formule :C148H223N43O42S3Masse moléculaire :3,372.88 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
<p>Catalogue peptide; min. 95% purity</p>Formule :C107H141N22O37PS2Masse moléculaire :2,422.53 g/molTGF α(34-43) (rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H67N15O13S2Masse moléculaire :1,078.25 g/molMca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt
CAS :<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C66H82N16O17SDegré de pureté :Min. 95%Masse moléculaire :1,403.52 g/molLaminin Penta Peptide, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C26H43N9O7Masse moléculaire :593.7 g/mol[Ser25]-PKC (19-36) Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C93H159N35O25Masse moléculaire :2,167.52 g/molBiotinyl-MCH (salmon)
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H153N29O26S5Masse moléculaire :2,325.82 g/mol[Tyr15] Fibrinopeptide B, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H102N20O27Masse moléculaire :1,715.78 g/molbFGF Inhibitory Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H53N11O11Masse moléculaire :815.89 g/molKK4A
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H138N22O19Masse moléculaire :1,640.06 g/molAmyloid Dan Protein (1-34) (reduced)
<p>Catalogue peptide; min. 95% purity</p>Formule :C185H270N48O51S2Masse moléculaire :4,046.63 g/mol[Glu2]-TRH
<p>Catalogue peptide; min. 95% purity</p>Formule :C15H22N4O6Masse moléculaire :354.38 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS :<p>H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when</p>Formule :C28H53N7O8Degré de pureté :Min. 95%Masse moléculaire :615.76 g/molβ-Amyloid (12-28) - Cys
<p>Catalogue peptide; min. 95% purity</p>Formule :C92H140N26O26SMasse moléculaire :2,058.36 g/mol[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H253N53O42Masse moléculaire :3,555.01 g/mol26Rfa, Hypothalamic Peptide, frog
<p>Catalogue peptide; min. 95% purity</p>Formule :C127H197N37O36Masse moléculaire :2,818.21 g/mol
![Ghrelin-[Cys(AF647)] Human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1110382.webp&w=3840&q=75)
![[Val35] -β-Amyloid (1-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00311.webp&w=3840&q=75)
![[Lys0]-γ-1-MSH (41-58), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00561.webp&w=3840&q=75)
![[D-Ala2] Deltorphin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00826.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Glu3,4,7,10,14]-Conantokin G](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00410.webp&w=3840&q=75)
![[D-Trp2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00844.webp&w=3840&q=75)
![[Des-Asp10]Decorsin, Leech](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00243.webp&w=3840&q=75)
![[Ac-Cys4,DPhe7,Cys10] a-MSH (4-13), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00024.webp&w=3840&q=75)
![[Trp7,β-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00349.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[D-Ala2,DMet5] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00835.webp&w=3840&q=75)
![[β-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00348.webp&w=3840&q=75)
![[D-Pro2]-β-Casomorphin (1-5) , bovine, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00842.webp&w=3840&q=75)
![[D-Ala2, DArg6] Dynorphin A, (1-13), porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00836.webp&w=3840&q=75)
![[D-Tyr6, β-Ala11, β-Phe13, Nle14]-Bombesin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00196.webp&w=3840&q=75)
![[D-Trp8,D-Cys14]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00216.webp&w=3840&q=75)
![[D-Ala2]-β-Casomorphin (1-4) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00833.webp&w=3840&q=75)
![Biotin-[Gln1]-Gastrin I (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00106.webp&w=3840&q=75)
![[D-Asp1]-Amyloid-β-Protein (1-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00138.webp&w=3840&q=75)
![[Tyr1]-Adipokinetic Hormone, locust](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00892.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Tyr15] Fibrinopeptide B, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00156.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
