Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30479 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Defensin (human) HNP-2
<p>Catalogue peptide; min. 95% purity</p>Formule :C147H217N43O37S6Masse moléculaire :3,370.94 g/mol[Des-His1, Glu9]-Glucagon (1-29), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C148H221N41O47SMasse moléculaire :3,358.72 g/molBiotin-LC-Kemptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H86N16O12SMasse moléculaire :1,111.39 g/molTNF-α (31-45), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C69H122N26O22Masse moléculaire :1,667.90 g/mol[D-Ala2]-β-Casomorphin (1-5), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H35N5O7Masse moléculaire :553.6 g/molcAMP Dependent PK Inhibitor (5-22), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C84H137N29O26Masse moléculaire :1,969.16 g/molp3K, (Lys 58 Lys 60 Lys 63) Ea(52-68)
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H129N23O25Masse moléculaire :1,777.03 g/molBiotin-Kinase Domain of Insulin Receptor (5)
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H124N21O35SMasse moléculaire :1,996.04 g/mol[Pyr4]-MBP (4-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H100N20O17Masse moléculaire :1,391.61 g/mol[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor
<p>Catalogue peptide; min. 95% purity</p>Formule :C13H24N4O3Masse moléculaire :284.36 g/mol[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-675)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H66N10O18Masse moléculaire :1,023.07 g/molBiotin-Neuropeptide Y (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C199H300N57O60S2Masse moléculaire :4,514.98 g/mol[D-Ser14]-Humanin (HN)
<p>Catalogue peptide; min. 95% purity</p>Formule :C119H204N34O32S2Masse moléculaire :2,687.28 g/molLeucokinin IV
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H52N12O12Masse moléculaire :904.9 g/molDynorphin A (8-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H96N18O15Masse moléculaire :1,297.53 g/mol[D-Ala2] Met-Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H37N5O7SMasse moléculaire :587.70 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H102N16O17Masse moléculaire :1,319.58 g/mol[Tyr11]-Somatostatin
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H102N18O20S2Masse moléculaire :1,651.91 g/molα-Conotoxin GI
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H76N20O18S4Masse moléculaire :1,433.63 g/molHelodormin
<p>Catalogue peptide; min. 95% purity</p>Formule :C176H285N47O49Masse moléculaire :3,843.47 g/molCaspase 2 Substrate 1m (ICH-1), fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H44N6O12Masse moléculaire :716.8 g/molBiotin-LC-Protein Kinase G Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C69H121N25O18SMasse moléculaire :1,621 g/molAc-a-CGRP (19-37) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C88H139N25O26Masse moléculaire :1,963.24 g/molPreprogalanin 28-67, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C198H312N62O58Masse moléculaire :4,488.96 g/molβ-Amyloid (13-27)
<p>Catalogue peptide; min. 95% purity</p>Formule :C84H126N24O24Masse moléculaire :1,856.09 g/molBiotin-Obestatin (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C126H190N34O35Masse moléculaire :2,773.19 g/molBiotin-a-CGRP (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C173H281N53O51S2Masse moléculaire :4,015.69 g/molβ-Amyloid Protein Precursor (657-676)
<p>Catalogue peptide; min. 95% purity</p>Formule :C95H152N30O31Masse moléculaire :2,210.45 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C164H278N58O45S4Masse moléculaire :3,910.64 g/molSarafotoxin S6d
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H167N27O34S5Masse moléculaire :2,596 g/molEndothelin-1 (1-15), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H108N16O24S5Masse moléculaire :1,718.02 g/molAngiotensinogen (1-13)
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H116N22O17Masse moléculaire :1,645.9 g/molInterleukin II (60-70)
<p>Catalogue peptide; min. 95% purity</p>Formule :C68H104N14O14SMasse moléculaire :1,373.74 g/molmini-ANP
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H117N27O19S4Masse moléculaire :1,829.19 g/molSialokinin - 2
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H76N12O16SMasse moléculaire :1,145.31 g/molβ-Amyloid (1-33)
<p>Catalogue peptide; min. 95% purity</p>Formule :C164H242N46O51Masse moléculaire :3,673.94 g/molLamprey PQRFamide
<p>Catalogue peptide; min. 95% purity</p>Formule :C102H147N29O22S2Masse moléculaire :2,195.62 g/mol[Val3]-β-Casomorphin (1-4) amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C24H35N5O5Masse moléculaire :473.58 g/molproPT18
<p>Catalogue peptide; min. 95% purity</p>Formule :C96H163N35O23Masse moléculaire :2,175.59 g/molBone Matrix Proteins
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H67N13O14Masse moléculaire :954.06 g/molCathepsin S substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H66N12O9Masse moléculaire :871.08 g/molMMP-2/MMP-9 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H61N13O13SMasse moléculaire :1,012.1 g/mol[Ile76]-TNF-a (70-80) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H91N15O16Masse moléculaire :1,218.43 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H110N24O14Masse moléculaire :1,403.71 g/molLocustachykinin I
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H63N13O11Masse moléculaire :938 g/molLKRApYLG-NH2
<p>Catalogue peptide; min. 95% purity</p>Formule :C38H67N12O11PMasse moléculaire :899.03 g/mol[Tyr1]-Adipokinetic Hormone, locust
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H78N14O15Masse moléculaire :1,211.5 g/molAc-Adhesin (1025-1044) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C97H160N26O32Masse moléculaire :2,202.51 g/molDynorphin A (2-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C90H146N30O21Masse moléculaire :1,984.36 g/mol[Trp11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formule :C80H122N22O19Masse moléculaire :1,696 g/molCalcium/Calmodulin Dependent Protein Kinase II-g (345-358)
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H107N21O22Masse moléculaire :1,450.63 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS :<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C59H84N18O14Degré de pureté :Min. 95%Masse moléculaire :1,269.41 g/molLys-(Hyp3)-Bradykinin
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H85N17O13Masse moléculaire :1,204.41 g/mol[D-Ala2,DMet5] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H37N5O7SMasse moléculaire :587.70 g/molSomatostatin-14 (3-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H72N12O11SMasse moléculaire :1,073.28 g/molMSH Release Inhibiting Factor, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C13H24N4O3Masse moléculaire :284.36 g/molBiotin-Secretin, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C140H234N46O42SMasse moléculaire :5,465.80 g/molβ-Casein (90-96)
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H175N35O27SMasse moléculaire :2,367.83 g/molAmyloid Bri Protein (1-34) (reduced)
<p>Catalogue peptide; min. 95% purity</p>Formule :C173H275N49O52S2Masse moléculaire :3,937.55 g/molZ-Ile-Val-OH
CAS :<p>Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C19H28N2O5Degré de pureté :Min. 95%Masse moléculaire :364.44 g/molR-G-D-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C15H26N7O7S1Masse moléculaire :448.48 g/mol[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C143H226N46O39Masse moléculaire :3,213.6 g/molPre-S1 (12-32)
<p>Catalogue peptide; min. 95% purity</p>Formule :C104H154N26O31SMasse moléculaire :2,296.61 g/mol[Tyr63] PTH (63-84), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H172N28O37Masse moléculaire :2,394.68 g/molY-R-G-D-S
<p>Catalogue peptide; min. 95% purity</p>Formule :C24H36N8O10Masse moléculaire :596.60 g/molDok-4 (130-145)
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H128N22O25SMasse moléculaire :1,866.1 g/molCasein Kinase II Receptor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H87N19O24Masse moléculaire :1,362.3 g/molGnT-V (nt38-67)
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H89N13O13SMasse moléculaire :1,159.45 g/molPannexin-1 Fragment (4515)
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H104N22O20Masse moléculaire :1,441.62 g/mol[D-Pro194]-IL-1 β (193-195) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C15H28N4O5Masse moléculaire :344.41 g/molLeucokinin III
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H52N12O13Masse moléculaire :908.9 g/molInsulin-Like Growth Factor II (69-84)
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H124N20O26Masse moléculaire :1,817.9 g/molAc-d-Endorphin (bovine, camel, mouse, ovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C138H217N35O40SMasse moléculaire :3,038.54 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
<p>Catalogue peptide; min. 95% purity</p>Formule :C107H141N22O37PS2Masse moléculaire :2,422.53 g/molα-Substance IB
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H51N9O7Masse moléculaire :685.82 g/molIntermedin (rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C226H361N75O64S2Masse moléculaire :5,216.99 g/molHepatitis B Virus Receptor Binding Fragment
<p>Catalogue peptide; min. 95% purity</p>Formule :C140H185N35O42Masse moléculaire :3,030.17 g/molNon-Ab Component of Alzheimer's Disease Amyloid
<p>Catalogue peptide; min. 95% purity</p>Formule :C141H235N39O49Masse moléculaire :3,260.68 g/mol[Pro34]-Neuropeptide Y, human, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/molBDC 2.5(A)
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H99N19O14SMasse moléculaire :1,342.64 g/molAc-Neurotrophin Receptor (368-381) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C69H124N22O19Masse moléculaire :1,565.89 g/molβ-Endorphin (1-5), (16-31), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H173N27O29SMasse moléculaire :2,393.86 g/molHistone H3 (116-136), N15-39
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H197N39O30Masse moléculaire :2,570 g/molAcyl Carrier Protein (65-74) (acid)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H74N12O16Masse moléculaire :1,063.18 g/molSMCY (950-960) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H85N15O18Masse moléculaire :1,172.31 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H109N23O23Masse moléculaire :1,592.74 g/molAllatostatin VII
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H69N13O13SMasse moléculaire :1,044.2 g/molAc-ACTH (1-14), 10-1-12A
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H111N21O21SMasse moléculaire :1,722.96 g/molOrn8, Urotensin II, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H85N13O18S2Masse moléculaire :1,376.60 g/molTNF-α (46-65) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H172N24O30Masse moléculaire :2,310.74 g/molDynorphin A (3-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H114N22O12Masse moléculaire :1,383.76 g/molAmyloid Dan Protein (1-34)
<p>Catalogue peptide; min. 95% purity</p>Formule :C185H268N48O51S2Masse moléculaire :4,044.63 g/molβ-Endorphin (27-31) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H45N7O9Masse moléculaire :623.71 g/molNTB (Naltriben)
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H65N11O11S2Masse moléculaire :1,060.29 g/molβ-Amyloid (31-35)
<p>Catalogue peptide; min. 95% purity</p>Formule :C25H47N5O6SMasse moléculaire :545.75 g/molPRRS-RSAB-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H61N11O18Masse moléculaire :1,020.03 g/molKinase Domain of Insulin Receptor (4)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H108N19O27Masse moléculaire :1,702.77 g/molCK1tide
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H96N18O27Masse moléculaire :1,549.58 g/molMurine CMV pp 89 (170-174)
<p>Catalogue peptide; min. 95% purity</p>Formule :C29H41N7O7SMasse moléculaire :631.76 g/molScyliorhinin II, amide ,dogfish
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H119N21O26S3Masse moléculaire :1,851.1 g/mol[Lys15]-Amyloid β-Protein (15-21)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H69N9O8Masse moléculaire :852.10 g/molHistone H1-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H101N17O15Masse moléculaire :1,252.53 g/mol[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :1,049.3 g/molLeucokinin V
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H46N10O11Masse moléculaire :782.8 g/molXenopsin (XP)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H73N13O10Masse moléculaire :980.20 g/molabII probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H101N19O19SMasse moléculaire :1,460.69 g/molAutocamtide-3 [KKALHRQETVDAL]
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H113N21O20Masse moléculaire :1,508.75 g/mol[D-Pro10]-Dynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H103N21O13Masse moléculaire :1,362.66 g/molα-Conotoxin EI
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H123N27O27S5Masse moléculaire :2,091.39 g/molβ-Amyloid (11-22)
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H102N18O18Masse moléculaire :1,483.70 g/molProlactin Releasing Peptide (12-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H156N32O25Masse moléculaire :2,242.59 g/molIsovaleryl-Val-Val-Sta-OEt
CAS :<p>Isovaleryl-Val-Val-Sta-OEt is a peptide hormone and active inhibitor of the enzyme pepsin. This drug has been shown to have proteolytic activity in vitro, with a pepsin rate constant of 0.0015 min−1. It also inhibits the protease activity of trypsin, chymotrypsin, and elastase at a similar rate. Isovaleryl-Val-Val-Sta-OEt has been shown to be an active inhibitor of polymerase chain reaction (PCR) and reverse transcriptase activities. This drug is not absorbed through skin and can be used as a nonimmunogenic reagent for biochemical studies on water permeability and signal peptide sequences in biological samples.</p>Formule :C25H47N3O6Degré de pureté :Min. 95%Masse moléculaire :485.66 g/molHuman IgE Pentapeptide HEPP
<p>Catalogue peptide; min. 95% purity</p>Formule :C22H36N8O11Masse moléculaire :588.58 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H81N21O17Masse moléculaire :1,236.32 g/mol4A/4B, Peptide (1)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H100N16O25S2Masse moléculaire :1,593.76 g/molPlatelet-Derived Growth Factor Receptor Substrate 2
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H86N13O22PMasse moléculaire :1,300.36 g/molHPV-E7-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C108H159N23O39S2Masse moléculaire :2,467.72 g/molKinase Domain of Insulin Receptor (3)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H108N19O27Masse moléculaire :1,702.77 g/molPDGFRtide
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H76N10O20Masse moléculaire :1,185.26 g/molSubstance P reversed sequence
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H98N18O13SMasse moléculaire :1,347.66 g/molTachykinin (111-129) β-Prepro (Human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C96H156N34O31SMasse moléculaire :2,314.59 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MMP Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H64N14O11Masse moléculaire :977.1 g/molAdrenomedullin (1-52), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molFibrinopeptide B
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H93N19O25Masse moléculaire :1,552.60 g/molGPC3 (298-306), mouse
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H81N9O18Masse moléculaire :1,108.26 g/mol[Phe7] Dynorphin A (1-7), amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H59N11O8Masse moléculaire :858.02 g/molLL-37 pentamide
<p>Catalogue peptide; min. 95% purity</p>Formule :C208H343N65O48Masse moléculaire :4,522.46 g/molSturgeon F
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H83N13O14SMasse moléculaire :1,254.48 g/molCalpain Inhibitor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C140H227N35O44SMasse moléculaire :3,136.64 g/molpp60 C-SRC Carboxy-Terminal Phosphoregulatory Peptide Phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H95N16O28PMasse moléculaire :1,543.53 g/molPKCe pseudosubstrate derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H155N39O21SMasse moléculaire :2,067.47 g/molCys-Gly-His-Gly-Asn-Lys-Ser-Amyloid β-Protein (33-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H99N19O18S2Masse moléculaire :1,414.67 g/molAntho-Rwamide II
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H44N10O6Masse moléculaire :640.79 g/molEpidermal Mitosis Inhibiting Pentapeptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C19H27N5O12Masse moléculaire :517.45 g/molTryptophan Motif Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H41N11O7Masse moléculaire :727.79 g/mol[Pyr5]-Substance P (5-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H57N9O9SMasse moléculaire :852.05 g/mol[D-Phe11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formule :C78H121N21O19Masse moléculaire :1,657 g/molα-CGRP (19-37), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H137N25O25Masse moléculaire :1,921.20 g/mol[D-Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H38N6O6SMasse moléculaire :586.72 g/molPAR-1-selective peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H58N10O9Masse moléculaire :762.91 g/molβ-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H53N13O6Masse moléculaire :727.87 g/molα-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)
<p>Catalogue peptide; min. 95% purity</p>Formule :C18H33N5O4Masse moléculaire :383.49 g/molPACAP-38, amide, frog
<p>Catalogue peptide; min. 95% purity</p>Formule :C204H333N63O53SMasse moléculaire :4,548.38 g/molProlactin Releasing Peptide (12-31), rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C104H158N32O26Masse moléculaire :2,272.62 g/molParallel topology β-Amyloid modified peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/molAmyloid β-Protein (20-29)
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H66N12O17Masse moléculaire :1,023.08 g/molIL-8ra (9-29)
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H150N24O38S2Masse moléculaire :2,504.71 g/molAc-β-Endorphin, bovine, camel, ovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H252N42O45SMasse moléculaire :3,479.99 g/molVIP-Lys(Biotin), human, porcine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C163H263N47O46S2Masse moléculaire :3,681.33 g/mol[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))
<p>Catalogue peptide; min. 95% purity</p>Formule :C111H191N39O29S2Masse moléculaire :2,600.07 g/molHPV-E6-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H178N36O30SMasse moléculaire :2,516.92 g/molGRF (free acid) (human)
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molAmyloid β-Protein (33-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H74N10O11SMasse moléculaire :915.17 g/molDoc-6 (130-145)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H134N26O26SMasse moléculaire :1,980.25 g/molδ1-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H97N21O14SMasse moléculaire :1,512.8 g/molPACAP(1-38)-Lys(Biotin), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C219H357N67O56S2Masse moléculaire :4,888.83 g/molBradykinin-Like Neuropeptide (3-11) (Aplysia californica)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H77N21O12Masse moléculaire :1,068.22 g/molPmc-S-methylisothiourea
CAS :<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>Formule :C16H24N2O3S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :356.51 g/molActh (1-4)
CAS :<p>Acth (1-4) is the ACTH N-terminal tetrapeptide.</p>Formule :C20H30N4O8SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :486.545-azido-pentanoyl-RKKRRQRRR-NH2 TFA salt
<p>Peptide 5-azido-pentanoyl-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Couleur et forme :PowderMasse moléculaire :1,463.78 g/molAc-YVAD-AOM
CAS :<p>Ac-YVAD-AOM is a selective and potent caspase-1 inhibitor showing antitumor activity and potential analgesic activity.</p>Formule :C33H42N4O10Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :654.71LHRH (1-5) (free acid) trifluoroacetate salt
CAS :<p>LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)</p>Formule :C34H38N8O9Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :702.71 g/molSermorelin acetate
CAS :Produit contrôlé<p>Sermorelin acetate is a synthetic peptide, which is an analogue of the naturally occurring growth hormone-releasing hormone (GHRH). It is derived from recombinant DNA technology, representing the first 29 amino acids (1-29) of endogenous GHRH. Its mode of action involves binding to and activating the GHRH receptor on the anterior pituitary gland, which subsequently stimulates the release of growth hormone (GH) into the bloodstream.</p>Formule :C149H246N44O42S·C2H4O2Degré de pureté :Min. 95%Masse moléculaire :3,417.94 g/molAngiotensin A (1-7) trifluoroacetate
CAS :<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molCerebellin trifluoroacetate
CAS :<p>Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molH-ASCLYGQLPK-OH
<p>Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/mol1-Palmitoyl-rac-glycero-3-phosphocholine
CAS :<p>1-Palmitoyl-rac-glycero-3-phosphocholine is a biological lipid that has been shown to be a potent growth factor for cells in culture. It binds to DNA and modulates transcriptional regulation. 1-Palmitoyl-rac-glycero-3-phosphocholine also inhibits the production of lysophosphatidylcholine, which is an inflammatory mediator that promotes the release of histamine from mast cells. This compound may be useful as an antimicrobial agent, as it has been shown to inhibit the growth of bacteria and fungi.</p>Formule :C24H50NO7PDegré de pureté :Min. 95%Masse moléculaire :495.63 g/molZ-VRPR-FMK trifluoroacetate
CAS :<p>Z-VRPR-FMK trifluoroacetate is an apoptosis-inducing inhibitor that works by inhibiting a specific kinase in the human body. It has been shown to have anti-cancer properties and may be useful in the treatment of various types of cancer. Z-VRPR-FMK trifluoroacetate is a menthol analog that acts as an inhibitor of apoptosis, which is the process by which cells die naturally. This compound has been tested on Chinese hamster ovary cells and has been found to be effective at inducing apoptosis in these cells. Additionally, Z-VRPR-FMK trifluoroacetate has been shown to inhibit tylosin-induced apoptosis in human colon cancer cells. Overall, this compound shows promise as a potential therapeutic agent for the treatment of cancer and other diseases.</p>Formule :C34H50F4N10O9Degré de pureté :Min. 95%Masse moléculaire :818.8 g/molH-Leu-Leu-Gly-OH trifluroacetate
CAS :<p>Please enquire for more information about H-Leu-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C14H27N3O4•C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :415.4 g/molH-Gly-Leu-Gly-OH trifluroacetate
CAS :<p>Please enquire for more information about H-Gly-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C10H19N3O4•C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :359.3 g/molH-GILGFVFTL-OH
CAS :<p>FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).</p>Formule :C49H75N9O11Masse moléculaire :966.18 g/molCyclo(L-alanyl-L-tryptophyl) trifluoroacetate
CAS :<p>Please enquire for more information about Cyclo(L-alanyl-L-tryptophyl) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C14H15N3O2•(C2HF3O2)xDegré de pureté :Min. 95%Masse moléculaire :257.29 g/molH-Met-Gln-OH TFA salt
CAS :<p>H-Met-Gln-OH TFA salt is a recombinant human metalloproteinase that has been shown to activate polymorphonuclear and mononuclear cells. H-Met-Gln-OH TFA salt enhances the production of reactive oxygen species and induces the release of proinflammatory cytokines such as tumor necrosis factor alpha, interleukin 1, and interleukin 6. This protein also cleaves sulfoxide bonds in proteins, which may be due to its ability to catalyze the oxidation of sulfhydryl groups in proteins. H-Met-Gln-OH TFA salt has been shown to be effective in enhancing red blood cell production, which may be due to its ability to cleave hemoglobin S bonds in erythrocytes.</p>Formule :C10H19N3O4SDegré de pureté :Min. 95%Masse moléculaire :277.34 g/molCoibamide A
CAS :<p>Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/molMycosubtilin
CAS :<p>Mycosubtilin is a potent antifungal lipopeptide, which is a secondary metabolite produced by the bacterium Bacillus subtilis. It is characterized by its ability to disrupt fungal cell membranes, leading to cell lysis and eventual death of the fungus. This mode of action is attributed to its amphiphilic structure, which allows it to integrate into the lipid bilayers of fungal cells, compromising the integrity of the membrane and altering its permeability.Mycosubtilin finds applications in various scientific and agricultural fields due to its efficacy against a broad spectrum of fungal pathogens. It is particularly useful in plant disease management, where it plays a role in biocontrol strategies against phytopathogenic fungi. Additionally, its antifungal properties make it a subject of interest in pharmaceutical research, where it is investigated for potential therapeutic applications in combating fungal infections. Researchers also explore Mycosubtilin as a model compound to understand lipopeptide interactions with membranes, contributing to the broader knowledge of antimicrobial agents.</p>Pheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea)
CAS :<p>Please enquire for more information about Pheromone Cymit Quimicaesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C167H259N47O57S2Degré de pureté :Min. 95%Masse moléculaire :3,901.26 g/molDansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt
CAS :<p>Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is a fluorescent marker that can be used in immunohistochemical staining. It binds to endogenous vasoactive intestinal peptide, calcitonin and other proteins in tissues and can be detected using immunostaining. Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is optimised for use as a substrate for neutral endopeptidase and metalloendopeptidase enzymes, which are responsible for the degradation of vasoactive intestinal peptide.</p>Formule :C28H32N6O9S·C2HF3O2Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :742.68 g/molTPCN1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPCN1 antibody, catalog no. 70R-5158</p>Degré de pureté :Min. 95%Lysyllysyllysine
CAS :<p>Lysyllysyllysine is a cationic moiety. It may be used in the construction of gene delivery vectors and DNA nanoparticles.</p>Formule :C18H38N6O4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :402.53Carnostatine
<p>Carnostatine (SAN9812), a potent CN1 inhibitor with 11 nM K i, may boost renal carnosine to treat DN.</p>Formule :C10H16N4O4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :256.26D-2-Phenylglycine
CAS :Formule :C8H9NO2Degré de pureté :>99.0%(T)Couleur et forme :White to Almost white powder to crystalMasse moléculaire :151.17N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-L-norvaline
CAS :Formule :C20H21NO4Degré de pureté :>98.0%(T)(HPLC)Couleur et forme :White to Almost white powder to crystalMasse moléculaire :339.39Proctolin
CAS :<p>Proctolin modulates interneuronal and neuromuscular synaptic transmission in a wide variety of arthropods. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formule :C30H48N8O8Masse moléculaire :648.76Somatostatin 28
CAS :<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formule :C137H207N41O39S3Couleur et forme :White to off-white, PowderMasse moléculaire :3148.58LH-RH, Salmon
<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Substance P-Gly-Lys-Arg
<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formule :C77H124N24O17SMasse moléculaire :1690.05Oxyntomodulin
CAS :<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formule :C192H295N59O60SCouleur et forme :Lyophilized powder, WhiteMasse moléculaire :4421.9Neuropeptide Y-Lys(biotin), Human, rat
<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formule :C199H300N57O60S2Masse moléculaire :4515.04Dynorphin A (1-13), Porcine
CAS :<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Couleur et forme :Lyophilized powderHistatin 5
<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>GSK-3 Inhibitor X
<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Glucagon (1-29) trifluoroacetate salt, human
CAS :<p>A peptide hormone that plays a role in maintaining glucose homeostasis This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Couleur et forme :White, Lyophilized powder1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide
CAS :Formule :C8H17N3Degré de pureté :98%Couleur et forme :LiquidMasse moléculaire :155.2407
![[Des-His1, Glu9]-Glucagon (1-29), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00740.webp&w=3840&q=75)
![[D-Ala2]-β-Casomorphin (1-5), bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00829.webp&w=3840&q=75)
![[Pyr4]-MBP (4-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00186.webp&w=3840&q=75)
![[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00620.webp&w=3840&q=75)
![[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-675)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00713.webp&w=3840&q=75)
![[D-Ser14]-Humanin (HN)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00594.webp&w=3840&q=75)
![[D-Ala2] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00839.webp&w=3840&q=75)
![[Tyr11]-Somatostatin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00218.webp&w=3840&q=75)
![[Val3]-β-Casomorphin (1-4) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00914.webp&w=3840&q=75)
![[Ile76]-TNF-a (70-80) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00637.webp&w=3840&q=75)
![[Tyr1]-Adipokinetic Hormone, locust](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00892.webp&w=3840&q=75)
![[Trp11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00192.webp&w=3840&q=75)
![[D-Ala2,DMet5] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00835.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00489.webp&w=3840&q=75)
![[Tyr63] PTH (63-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00861.webp&w=3840&q=75)
![[D-Pro194]-IL-1 β (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[Lys15]-Amyloid β-Protein (15-21)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00531.webp&w=3840&q=75)
![[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00141.webp&w=3840&q=75)
![Autocamtide-3 [KKALHRQETVDAL]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00520.webp&w=3840&q=75)
![[D-Pro10]-Dynorphin A (1-11), porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00870.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Phe7] Dynorphin A (1-7), amide, porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00865.webp&w=3840&q=75)
![Atrial Natriuretic Peptide Substrate, [pS6] ANF 1-28](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00729.webp&w=3840&q=75)
![[Pyr5]-Substance P (5-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00195.webp&w=3840&q=75)
![[D-Phe11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00191.webp&w=3840&q=75)
![[D-Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00838.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00016.webp&w=3840&q=75)
![[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00600.webp&w=3840&q=75)
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-L-norvaline](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3B%2Fthumb-webp%2FF1117.webp&w=3840&q=75)
