Peptides

<p>MTP 131 (acetate) is a small mitochondrially-targeted tetrapeptide.</p>

<p>Elamipretide (SS-31, MTP-131, Bendavia) is a mitochondria-focused peptide that curbs toxic ROS and stabilizes cardiolipin.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Protected amino acid</p>

<p>Peptide TAPI-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a synthetic peptide that binds to the integrin receptor on pancreatic cancer cells. It has been shown to be an effective diagnostic tool for pancreatic cancer and other cancers, such as prostate, breast, and lung. Cyclo(Arg-Gly-Asp-D-Phe-Lys) selectively binds to cells with high levels of integrin receptors by using "a heterofunctional approach." This technique is used in the synthesis of peptides because it increases the stability of peptides. Cyclo(Arg-Gly-Asp-D-Phe-Lys) can be used for diagnosis or therapeutic purposes.</p>

<p>Peptide H-SAYVSYDVQK^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide TAPI-O is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide TAPI-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ILGQQVPYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>SK channel blocker</p>

<p>Peptide H-SSLLDVLAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Lysine peptide (Ac RFAAKAA COOH) is used in combination with cysteine peptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>

<p>Peptide H-LVYHLGLPFSFLTFPYVEEAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DGRGDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MRWQEMGYIFYPRKLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALNRTSSDSALHRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALNRTSSDSALHRRR-OH include the following: Enhanced activation of cellular AMPK by dual-small molecule treatment: AICAR and A769662 S Ducommun , RJ Ford, L Bultot - American Journal , 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013</a> Characterization of WZ4003 and HTH-01-015 as selective inhibitors of the LKB1-tumour-suppressor-activated NUAK kinases S Banerjee , SJ Buhrlage, HT Huang , X Deng - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/457/1/215/46906" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/457/1/215/46906</a> Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1betaMYPT1 phosphatase complex and the SCFbetaTrCP E3 ubiquitin ligase S Banerjee , A Zagorska, M Deak - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/461/2/233/46874" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/461/2/233/46874</a> Inhibition of SIK2 and SIK3 during differentiation enhances the anti-inflammatory phenotype of macrophages NJ Darling , R Toth, JSC Arthur , K Clark - Biochemical Journal, 2017 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/474/4/521/49590" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/474/4/521/49590</a> Comparison of the specificity of Trk inhibitors in recombinant and neuronal assays KJ Martin, N Shpiro, R Traynor, M Elliott , JSC Arthur - Neuropharmacology, 2011 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0028390811001389" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0028390811001389</a> Enhanced activation of cellular AMPK by dual small GR Kemp, K Sakamoto - 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013</a> The AMPK-related kinase SIK2 is regulated by cAMP via phosphorylation at Ser358 in adipocytes E Henriksson, HA Jones, K Patel , M Peggie - Biochemical , 2012 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/444/3/503/46279" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/444/3/503/46279</a></p>

<p>Peptide H-VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GYGFGLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease. TFA salt; 95%.</p>

<p>H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-IYQEPFKNLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RINSAKDDAAGLQIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Prostaglandin A1 is a bioactive lipid, which is derived from arachidonic acid through enzymatic pathways. It functions as a signaling molecule with various biological activities, influencing vascular tone, inflammation, and smooth muscle activity. Prostaglandins are a subset of eicosanoids, which are synthesized from essential fatty acids found within phospholipid membranes of cells.</p>

<p>Peptide H-NWAPGEPNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VIYEQANAHGQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVSEDFLQDVSASTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GDSLAYGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VAANIVLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DRFYKTLRAEQASQEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>