CRF (human, rat)

CAS : 86784-80-7

Ref. 01-4011473

Informations sur le produit

• Nom: CRF (human, rat)
• Synonymes: Corticorelin, Corticotropin-Releasing Factor, Human and Rat, Crf (Human, Rat)

Description

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.

• Marque: Bachem

Propriétés chimiques

• Masse moléculaire: 4757.52
• Formule: C₂₀₈H₃₄₄N₆₀O₆₃S₂
• Degré de pureté: ≥ 99%
• Couleur/Forme: White Powder