
CRF (human, rat)
CAS :
Ref. 01-4011473

Informations sur le produit
Nom:CRF (human, rat)
Synonymes :
- Corticorelin
Marque:Bachem
Description :CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.
Propriétés chimiques
Masse moléculaire :4757.52
Formule :C208H344N60O63S2
Degré de pureté :≥ 99%
Couleur/Forme :White