NCAPH2 antibody
Ref. 3D-70R-2268
100µl | 762,00 € |
Informations sur le produit
NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE
Propriétés chimiques
Question d’ordre technique sur : 3D-70R-2268 NCAPH2 antibody
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages