Informations sur le produit
Nom:beta 2 Microglobulin antibody
Marque:Biosynth
Description :beta 2 Microglobulin antibody was raised using the N terminal of B2M corresponding to a region with amino acids MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.
Propriétés chimiques
Degré de pureté :Min. 95%