ACTH (1-39) Human

Ref. 3D-CRB1000076

Informations sur le produit

• Nom: ACTH (1-39) Human
• Synonymes: H-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OHAdrenocorticotropic hormone (1-39)SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-acidH-Ser-T yr-Ser-Met-Glu-His-P he-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-A sn-Gly-Ala-Glu-Asp-Glu-Ser-A
• Marque: Biosynth
• Description: Human adrenocorticotropic hormone (ACTH) also known as corticotropin. ACTH is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase.Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency

Propriétés chimiques

• Masse moléculaire: 4,541.07 g/mol
• Couleur/Forme: Powder