
Amylin (1-37) Human
Ref. 3D-CRB1000269
1mg
588,00€
500µg
477,00€

Informations sur le produit
Nom:Amylin (1-37) Human
Synonymes :
- [Cyc(2,7)]H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-OHKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-acid
- Disulphide bridge Cys2-Cys7H-Lys-C ys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-As
Marque:Biosynth
Description :Amylin, also known as islet amyloid polypeptide (IAPP), is a peptide hormone which is deficient in patients with diabetes mellitus (DM). Amylin is co-secreted with insulin from the pancreatic β-cells. It inhibits glucagon secretion, delays gastric emptying, and thus acts as a satiety agent. Amylin peptide is capable of forming aggregates, and pancreatic amyloid plaques are present in 90% of patients with DM. Formation of these plaques may be inhibited by insulin via the formation of heteromolecular complexes. Amylin is also involved in adiposity signalling and body weight regulation.Amylin is expressed in the human placenta during pregnancy where it may help regulate food intake by both the mother and foetus, and is involved in foetal development of bone, kidneys and pancreas.
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.
Propriétés chimiques
Masse moléculaire :3,901.85 g/mol
Couleur/Forme :Powder
Question d’ordre technique à propos de: Amylin (1-37) Human
Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande
Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande. Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages.