CymitQuimica logo

Exendin 4 (4-39)

Ref. 3D-CRB1000423

1mg
477,00€
500µg
349,00€
Exendin 4 (4-39)
Biosynth

Informations sur le produit

Nom:Exendin 4 (4-39)
Synonymes :
  • H-GTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2GTFTSDLSKQMEEEAVRLFIE-W-LKNGGPSSGAPPPS-amideH-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Me t-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-T rp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Marque:Biosynth
Description :This is a truncated exendin-4 peptide, the original peptide was identified in Gila monster lizard (Heloderma suspectum). Exendin-4 is an incretin mimetic, an analog of glucagon-like-peptide-1 (GLP-1), it stimulates insulin secretion and modulates gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-4 is resistant to cleavage by plasma DPP-IV unlike GLP-1. This gives it a longer half-life and duration of action than GLP-1, as well as greater potency in vivo. Exendin-4 increases insulin sensitivity and improves glucose tolerance and is currently used for the treatment of Type 2 diabetes mellitus in its synthetic form Exenatide.Exendin-4 also promotes the production and proliferation of β-cells leading to regeneration of the pancreas. It is a ligand to the exendin receptor and increases pancreatic acinar cell cAMP levels. However, the GLP-1 analog was found to have a toxic effect by inducing hypotension due to relaxation of the cardiac smooth muscle.
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.

Propriétés chimiques

Masse moléculaire :3,860.9 g/mol
Couleur/Forme :Powder

Question d’ordre technique à propos de: Exendin 4 (4-39)

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande. Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages.
◻️
CYMIT QUÍMICA, S.L., en tant que responsable du traitement de vos données personnelles, traitera ces dernières afin de répondre à vos questions ou demandes. Vous pouvez accéder à vos données, les corriger et les supprimer. Vous pouvez exercer vos autres droits en consultant les informations complémentaires et détaillées sur la protection des données dans notre politique de confidentialité du site.
* Champ obligatoire.