
Biotin-β Amyloid (1-42) Human
Ref. 3D-CRB1000486
100µg
386,00€
500µg
470,00€

Informations sur le produit
Nom:Biotin-β Amyloid (1-42) Human
Synonymes :
- Biot-(Ahx)DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OHBiotin-Ahx-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-acidBiotin-Ahx-Asp-Al a-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Ly s-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Ser-Asn-Lys-Gly-Ala-Ile
Marque:Biosynth
Description :Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.This peptide contains a covalently attached N-Terminal biotin tag for convenient detection and purification.
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.
Propriétés chimiques
Degré de pureté :Min. 95%
Couleur/Forme :Powder
Question d’ordre technique à propos de: Biotin-β Amyloid (1-42) Human
Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande
Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande. Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages.