Le produit a bien été ajouté au panier.

discount label
GIP (1-42)-[C] human
Vue en 3D

Biosynth logo

GIP (1-42)-[C] human

Ref. 3D-CRB1000509

1mg
462,00 €
100µg
276,00 €
500µg
379,00 €
Livraison estimée en/au États-Unis, le lundi 22 juillet 2024

Informations sur le produit

Nom :
GIP (1-42)-[C] human
Synonymes :
  • H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQC-NH2
Description :

Peptide derived from the Gastric inhibitory polypeptide (GIP), an inhibiting hormone of the secretin family of hormones. While GIP is a weak inhibitor of gastric acid secretion, its main role is to stimulate insulin secretion - in a glucose-dependent mechanism. Therefore, GIP is referred to as a glucose-dependent insulinotropic peptide.GIP is derived from a 153-amino acid pro-protein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. It is synthesised by K cells, which are found in the mucosa of the duodenum and the jejunum of the gastrointestinal tract. GIP receptors are seven-transmembrane proteins found on β-cells in the pancreas. These β-cells are those that are able to simultaneously detect glucose and release insulin as a result to GIP binding.The clinical relevance of GIP is related to type 2 diabetes mellitus (T2DM)- studies have found that T2DM diabetics are unresponsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In research involving knockout mice, it was found that absence of the GIP receptors correlates with resistance to obesity.

Avis:
Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.
Marque:
Biosynth
Stockage à long terme :
Notes :

Propriétés chimiques

Masse moléculaire :
1,234.5 g/mol
MDL:
Point de fusion :
Point d'ébullition :
Point d'éclair :
Densité :
Concentration :
EINECS :
Merck :
Code SH :

Informations sur les risques

Numéro ONU :
EQ:
Classe :
Phrases R :
Phrases S :
Transport aérien interdit :
Informations sur les risques :
Groupe d'emballage :
LQ :

Question d’ordre technique sur : 3D-CRB1000509 GIP (1-42)-[C] human

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande

Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages

* Champ obligatoire
Bienvenue chez CymitQuimica !Nous utilisons des cookies pour améliorer votre visite. Nous n’incluons pas de publicité.

Veuillez consulter notre Politique de Cookies pour plus de détails ou ajustez vos préférences dans "Configurer".