CymitQuimica logo

Histone H3.2 (1-44)

Ref. 3D-CRB1000587

500µg
386,00€
1mg
470,00€
Histone H3.2 (1-44)
Biosynth

Informations sur le produit

Nom:Histone H3.2 (1-44)
Synonymes :
  • H-ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG-OH
Marque:Biosynth
Description :Histone H3.2 is a highly common variant of the core histone H3 which is found in all eukaryotes except budding yeast. H3.2 is replication-dependent and is associated with gene silencing. Histone variants can replace canonical histones in certain cells or stages of development and help regulate numerous nuclear processes including transcription, DNA repair and chromosome segregation.Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.

Propriétés chimiques

Masse moléculaire :4,668.7 g/mol

Question d’ordre technique à propos de: Histone H3.2 (1-44)

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande. Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages.
◻️
CYMIT QUÍMICA, S.L., en tant que responsable du traitement de vos données personnelles, traitera ces dernières afin de répondre à vos questions ou demandes. Vous pouvez accéder à vos données, les corriger et les supprimer. Vous pouvez exercer vos autres droits en consultant les informations complémentaires et détaillées sur la protection des données dans notre politique de confidentialité du site.
* Champ obligatoire.