LL-37 amide

CAS : 597562-32-8

Ref. 3D-CRB1000864

Informations sur le produit

• Nom: LL-37 amide
• Synonymes: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-amideH-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Gl u-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gl n-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2
• Marque: Biosynth
• Description: LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.

Propriétés chimiques

• Masse moléculaire: 4,493.3 g/mol
• Formule: C₂₀₅H₃₄₁N₆₁O₅₂