GLP-1 (7-36) [Cys(Sulfocyanine5)]

Ref. 3D-CRB1100802

Informations sur le produit

• Nom: GLP-1 (7-36) [Cys(Sulfocyanine5)]
• Synonymes: H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR(C/Sulfocyanine5)-NH2HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amideH-His-Ala-Glu-Gly-Th r-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala- Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-[Cys(Sulfocyanine5)

Description

The native form of GLP-1 in humans is the GLP-1 (7-36) amide. GLP-1 (7-36) amide is highly unstable (half-life <-2 minutes) due to proteolytic degradation by the serine protease, dipeptidyl peptidase-IV (DPP-IV). DPP-IV cleaves the N-terminal histidine and alanine residues from GLP-1 to generate two equipotent forms: GLP-1 (9-37) and GLP-1 (9-36) amide. This degradation mitigates against the therapeutic use of GLP-1 itself, therefore DPP-IV-resistant peptide analogues have been developed and licensed for clinical use.Contains a sulfo-Cyanine5 fluorescent dye, an analogy of Cy5® and one of the most popular fluorophores. Sulfo-Cyanine5 is a red emitting fluorescent dye which is highly hydrophilic and water-soluble. Compatible with various equipment such as plate readers, microscopes, and imagers.

• Marque: Biosynth

Propriétés chimiques

• Masse moléculaire: 4,162.9 g/mol
• Couleur/Forme: Powder