CymitQuimica logo

Exendin-4 [Lys(AF647)]

Ref. 3D-CRB1101572

100µg
543,00€
500µg
651,00€
Exendin-4 [Lys(AF647)]
Biosynth

Informations sur le produit

Nom:Exendin-4 [Lys(AF647)]
Synonymes :
  • H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS(K/AF647 DBCO)-NH2HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-[K(AF647 DBCO)]-amideH-His-Gly- Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu- Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-S
Marque:Biosynth
Description :Exendin-4 is part of a group of peptide hormones, the exendins. These are members of the glucagon superfamily of peptides and are secreted from the Gila monster lizard (Heloderma suspectum) venom gland. Exendins stimulate insulin secretion in response to rising blood glucose levels and modulate gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-4 increases insulin sensitivity and improves glucose tolerance in humans and animals with diabetes. Exendin-4 is currently used for treating type 2 diabetes mellitus in its synthetic form, Exenatide.Exendin-4 shares 53% sequence homology, and specific activities, with glucagon-like-peptide-1 (GLP-1). Enteroendocrine L-cells produce GLP-1 upon nutrient ingestion, its central role relates to insulin secretion. Unlike GLP-1, exendin-4 is resistant to cleavage by plasma dipeptidyl peptidase IV (DPP-IV), resulting in a longer half-life and duration of action than GLP-1, as well as greater potency in vivo. Exendin-4 binds and activates the glucagon-like peptide-1 receptor (GLP-1R). In addition to its role in insulin sensitivity, exendin-4 also has a role in pancreas development and has anti-cancer properties.This exendin-4 contains AF647, a structural analog to Alexa Fluor® 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides. If you desire an alternative dye, please contact us to request a custom synthesis.
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.

Propriétés chimiques

Masse moléculaire :5,454.4 g/mol

Question d’ordre technique à propos de: Exendin-4 [Lys(AF647)]

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande. Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages.
◻️
CYMIT QUÍMICA, S.L., en tant que responsable du traitement de vos données personnelles, traitera ces dernières afin de répondre à vos questions ou demandes. Vous pouvez accéder à vos données, les corriger et les supprimer. Vous pouvez exercer vos autres droits en consultant les informations complémentaires et détaillées sur la protection des données dans notre politique de confidentialité du site.
* Champ obligatoire.