
Glucagon (1-29)-[Lys(AF647)]
Ref. 3D-CRB1101573
100µg
349,00€
500µg
477,00€

Informations sur le produit
Nom:Glucagon (1-29)-[Lys(AF647)]
Synonymes :
- H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT(K/AF647 DBCO)-NH2HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Lys(AF647 DBCO)]-amideH-His-Ser-Gln-Gly-Thr-Phe-Th r-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala- Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-[Lys(AF647 DBCO)]-NH2
Marque:Biosynth
Description :Glucagon (1-29)-[Lys(AF647)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels.This peptide contains AF647, structural analog to Alexa Fluor® 647 which is a widely used far-red fluorescent dye.
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.
Propriétés chimiques
Masse moléculaire :4,750 g/mol
Degré de pureté :Min. 95%
Couleur/Forme :Powder
Question d’ordre technique à propos de: Glucagon (1-29)-[Lys(AF647)]
Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande
Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande. Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages.